KEGG   Drosophila erecta: Dere_GG15687Help
Entry
Dere_GG15687      CDS       T01060                                 

Definition
GG15687 gene product from transcript GG15687-RA
Orthology
K10723  
ecdysone 20-monooxygenase [EC:1.14.99.22]
Organism
der  Drosophila erecta
Pathway
Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    Dere_GG15687
Enzymes [BR:der01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.22  ecdysone 20-monooxygenase
     Dere_GG15687
Cytochrome P450 [BR:der00199]
 Cytochrome P450, animal type
  CYP314 family
   Dere_GG15687
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 540 aa AA seqDB search
MAVILLLALALVLGCYCALHRHKLADIYLRPLLKNTLLEDFYHAELIQPEAPKRRRRGIW
DIPGPKRIPFLGTKWIFLLFFRRYKMTKLHEVYADLNRQYGDIVLEVMPSNVPIVHLYNR
EDLEKVLKYPSKYPFRPPTEIIVMYRQSRPDRYASVGIVNEQGPMWQRLRSSLTSSITSP
RVLQNFLPALNAVCDDFIELLRARRDPATLVVPNFEELANLMGLEAVCTLMLGRRMGFLA
VDTKQPQKISQLAAAVKQLFISQRDSYYGLGLWKYFPTKTYRDFARAEDLIYDVISEIID
HELEELKKSAACEDDEVAGLRSIFLNILELKDLDIRDKKSAIIDFIAAGIETLANTLLFV
LSSVTGDPGAMPRILGEFCEYRDTNILQDALTNATYTKACIQESYRLRPTAFCLARILEE
DMELSGYSLNAGTVVLCQNMIACHKDSNFHGAKQFSPERWIDPATENFTVNVDNASIVVP
FGVGRRSCPGKRFVEMEVVLLLAKMVLAFDVSFVKPLETEFEFLLAPKTPLSLRLSDRVF
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgatactgttgctggccctggcactcgtacttggctgctactgcgctctccat
cggcacaaactggcggatatctacctccggccgctactgaagaacacgctcctggaggac
ttctaccatgccgagctgatccagcccgaggcgccaaagaggcgaaggcgcggcatctgg
gacattcccgggccaaagaggattcccttcctgggcaccaaatggatattcctgctcttc
tttcgccgctacaagatgaccaagctgcacgaggtatatgcggatctgaacaggcagtat
ggtgacatagtgctggaggtgatgccctccaatgtgcccatagtgcacctgtacaatcgc
gaggatctggagaaggtgctgaagtaccccagcaagtatccattccgacctcccaccgag
atcatcgtgatgtaccgtcaatcccgaccggatcgctatgcgagtgtgggaattgtgaac
gagcagggaccaatgtggcagcgcctgcgatcctcgctgacctccagcattacttctccc
agggtcctgcagaatttcctgccagccctgaatgcggtttgtgatgattttatcgaacta
ctgcgagctaggcgggatccggctacactggtggtgcccaacttcgaggagctggccaat
ctgatgggcctggaagcagtgtgcaccttgatgttgggcagaagaatgggtttcctggct
gtcgacaccaagcagccgcaaaagatcagccaactggcagctgctgtcaagcagcttttc
atctcccaaagggactcgtactacggtctgggtctgtggaaatactttcccaccaaaacc
tacagggactttgcccgcgccgaggacttgatctatgatgtgatctccgagatcatcgat
catgagctggaggaactcaagaagtcggctgcctgcgaggatgacgaggttgctggctta
cggagtatctttctcaatattctggagcttaaggatctggatatcagggacaaaaagtcg
gctatcatagactttattgccgctggcatagaaacgttagccaacacattgttgtttgtg
ctgagttctgttactggagatcctggggccatgccccgtatcttgggtgaattctgcgag
tatcgggacacgaatatcctgcaggacgctctaacgaatgccacatacacaaaggcctgt
attcaggagtcctacagactgaggcccaccgccttttgcctggccaggattctggaggag
gacatggagctctcgggttactcgcttaatgcagggactgtggtgctttgtcaaaatatg
atagcctgccacaaggacagcaacttccacggagccaagcagtttagcccagagcgttgg
atcgatcctgccacggagaacttcacggtgaacgtggataatgccagtattgtggtgccc
ttcggagtgggtcgaagatcgtgtccaggaaagcggtttgtggaaatggaggtggtgctg
ctgctagcaaagatggtcctagcctttgacgtgagctttgtgaagccactggaaacggag
ttcgagttcctgctggcacccaaaactccactcagtcttagactcagcgatcgggttttc
tga

DBGET integrated database retrieval system