KEGG   Drosophila erecta: Dere_GG15687Help
Entry
Dere_GG15687      CDS       T01060                                 

Definition
GG15687 gene product from transcript GG15687-RA
Orthology
K10723  
ecdysone 20-monooxygenase [EC:1.14.99.22]
Organism
der  Drosophila erecta
Pathway
Insect hormone biosynthesis
Class
Metabolism; Metabolism of terpenoids and polyketides; Insect hormone biosynthesis [PATH:der00981]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 540 aa AA seqDB search
MAVILLLALALVLGCYCALHRHKLADIYLRPLLKNTLLEDFYHAELIQPEAPKRRRRGIW
DIPGPKRIPFLGTKWIFLLFFRRYKMTKLHEVYADLNRQYGDIVLEVMPSNVPIVHLYNR
EDLEKVLKYPSKYPFRPPTEIIVMYRQSRPDRYASVGIVNEQGPMWQRLRSSLTSSITSP
RVLQNFLPALNAVCDDFIELLRARRDPATLVVPNFEELANLMGLEAVCTLMLGRRMGFLA
VDTKQPQKISQLAAAVKQLFISQRDSYYGLGLWKYFPTKTYRDFARAEDLIYDVISEIID
HELEELKKSAACEDDEVAGLRSIFLNILELKDLDIRDKKSAIIDFIAAGIETLANTLLFV
LSSVTGDPGAMPRILGEFCEYRDTNILQDALTNATYTKACIQESYRLRPTAFCLARILEE
DMELSGYSLNAGTVVLCQNMIACHKDSNFHGAKQFSPERWIDPATENFTVNVDNASIVVP
FGVGRRSCPGKRFVEMEVVLLLAKMVLAFDVSFVKPLETEFEFLLAPKTPLSLRLSDRVF
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgatactgttgctggccctggcactcgtacttggctgctactgcgctctccat
cggcacaaactggcggatatctacctccggccgctactgaagaacacgctcctggaggac
ttctaccatgccgagctgatccagcccgaggcgccaaagaggcgaaggcgcggcatctgg
gacattcccgggccaaagaggattcccttcctgggcaccaaatggatattcctgctcttc
tttcgccgctacaagatgaccaagctgcacgaggtatatgcggatctgaacaggcagtat
ggtgacatagtgctggaggtgatgccctccaatgtgcccatagtgcacctgtacaatcgc
gaggatctggagaaggtgctgaagtaccccagcaagtatccattccgacctcccaccgag
atcatcgtgatgtaccgtcaatcccgaccggatcgctatgcgagtgtgggaattgtgaac
gagcagggaccaatgtggcagcgcctgcgatcctcgctgacctccagcattacttctccc
agggtcctgcagaatttcctgccagccctgaatgcggtttgtgatgattttatcgaacta
ctgcgagctaggcgggatccggctacactggtggtgcccaacttcgaggagctggccaat
ctgatgggcctggaagcagtgtgcaccttgatgttgggcagaagaatgggtttcctggct
gtcgacaccaagcagccgcaaaagatcagccaactggcagctgctgtcaagcagcttttc
atctcccaaagggactcgtactacggtctgggtctgtggaaatactttcccaccaaaacc
tacagggactttgcccgcgccgaggacttgatctatgatgtgatctccgagatcatcgat
catgagctggaggaactcaagaagtcggctgcctgcgaggatgacgaggttgctggctta
cggagtatctttctcaatattctggagcttaaggatctggatatcagggacaaaaagtcg
gctatcatagactttattgccgctggcatagaaacgttagccaacacattgttgtttgtg
ctgagttctgttactggagatcctggggccatgccccgtatcttgggtgaattctgcgag
tatcgggacacgaatatcctgcaggacgctctaacgaatgccacatacacaaaggcctgt
attcaggagtcctacagactgaggcccaccgccttttgcctggccaggattctggaggag
gacatggagctctcgggttactcgcttaatgcagggactgtggtgctttgtcaaaatatg
atagcctgccacaaggacagcaacttccacggagccaagcagtttagcccagagcgttgg
atcgatcctgccacggagaacttcacggtgaacgtggataatgccagtattgtggtgccc
ttcggagtgggtcgaagatcgtgtccaggaaagcggtttgtggaaatggaggtggtgctg
ctgctagcaaagatggtcctagcctttgacgtgagctttgtgaagccactggaaacggag
ttcgagttcctgctggcacccaaaactccactcagtcttagactcagcgatcgggttttc
tga

DBGET integrated database retrieval system