KEGG   Drosophila erecta: Dere_GG15734Help
Entry
Dere_GG15734      CDS       T01060                                 

Definition
GG15734 gene product from transcript GG15734-RA
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dere_GG15734
Peptidases [BR:der01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dere_GG15734
Transcription machinery [BR:der03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Dere_GG15734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 496 aa AA seqDB search
MSETGCRHYQSYVKEHSYDTFRVIDAYFAACVNRDARERKAIHCSCFECGSYGIQLYACL
HCIYFGCRGAHITSHLRSKKHNVALELSHGTLYCYACRDFIYDARSREYALTNRKLEAKD
LQKSIGWVPWVPTAKETNLLLANARRRLVRPNQTIGLRGLLNLGATCFMNCIVQALVHTP
LLSDYFMSDRHDCGSKSSPKCLVCEVSRLFQEFYSGSRSPLSLHRLLHLIWNHAKHLAGY
EQQDAHEFFIATLDVLHRHCVKAKAEHDSKSNSSGTGSGTNSSNSSSSHCYGQCNCIIDQ
IFTGMLQSDVVCQACNGVSTTYDPFWDISLDLGETTTHGGVTPKTLIDCLERYTRAEHLG
SAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFEHSALIDRKISSFIQFPVEFDMTP
FMSEKKNAYGDFRFSLYAVVNHVGTIDTGHYTAYVRHQKDTWVKCDDHVITMASLKQVLD
SEGYLLFYHKNVLEYE
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagacgggctgtcggcactaccagagctacgtgaaggagcacagctacgataca
ttccgtgtcatcgacgcctacttcgctgcctgcgtcaacagagatgcgcgcgagcgaaag
gctattcactgcagctgcttcgagtgcggcagctacggcatccagttgtacgcctgtctg
cactgcatctacttcggatgtcgaggggcccacatcacgagtcacctgcgatccaagaag
cacaatgtggccctggagctgtcccacggaacgctctactgctacgcctgccgagatttc
atctacgacgcgaggagccgggagtatgcgctgaccaaccgcaagctggaagccaaggat
ctccagaagagcatcggctgggtgccgtgggtgcccacggccaaggagaccaatctgctg
ctggccaacgcaaggcgtcgactggtgcggcccaatcaaacgatcggactgaggggtctg
ctcaatctgggggccacttgcttcatgaactgcatcgtccaggctctggttcatacgccc
ctgcttagcgactacttcatgtcagatcgccacgactgcggcagcaagtcctcgcccaag
tgtctcgtttgcgaagtttcgcgtctcttccaggagttctattctggctcccgttcgccg
ttgtcgctgcaccggctactgcatttaatctggaaccatgcgaagcacttggccggctac
gagcagcaggacgcgcacgagttcttcatcgccacactggacgtgctgcatcggcactgc
gtgaaggcaaaggcggagcacgatagcaagagcaacagctctggcacgggaagtggcact
aattcgagcaactcgagcagctcgcattgctatggccagtgtaattgcatcatcgaccag
atcttcacgggcatgctgcagagcgatgtggtgtgccaggcctgcaacggagtgtccacc
acctacgatcccttttgggacatttcgctggacctgggcgaaacaacaacgcatggtggt
gttaccccaaaaacgctgatagactgcctggagcggtatacacgggccgagcatctcgga
tcggccgccaaaatcaagtgctccacctgcaaatcctaccaggagtccaccaaacagttc
agcttgcgcactctgcccagcgtggtgtccttccatctgaaacgcttcgagcactctgct
ctcatcgatcgcaagatctcctcgttcattcaattccccgtggagttcgacatgacaccc
tttatgtccgaaaagaagaatgcctatggggacttccggttctctttgtacgccgtggtc
aatcacgtgggcaccatcgacaccggacactatacggcctatgtgcgccaccagaaggac
acgtgggtcaagtgcgatgatcatgtgataacgatggcgtcgctcaagcaggtgctggac
agcgagggttatttattgttctaccataaaaacgtgctggaatacgagtga

DBGET integrated database retrieval system