KEGG   Drosophila erecta: Dere_GG16065Help
Entry
Dere_GG16065      CDS       T01060                                 

Definition
GG16065 gene product from transcript GG16065-RA
Orthology
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.1.2.15]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dere_GG16065
Peptidases [BR:der01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dere_GG16065
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1760 aa AA seqDB search
MGTKESKHSNSVSYEDSVKRVSDVELRRLRDAFKKSAGVGRNFLSRNAFQQDVLCEGVPP
KIVDMLYAACGGTQRGISFNDLLCGLVLITRGTQAEKTKFLWNLYCNDAGTFIIKSDYVR
NVNLAPFESVSLFAQSERVNFDQFQDWIIKHRNATVLSKWLLADNCVSLTSELETPTFYQ
SLAGVTHLEEKDIGDLEKEFWRLKNTSQNGQIDLQFLGPLISPPIPKNALAGLFNAFDEN
RDGHIDFKELCCGVSAACRGPGVERTRFCFKIFDVDRDGVLSHEETLQMINVLLLVAKEN
REAQQYKDLTKQLVISDLLEFGQRRSPDGTPSKLTRDNVSLTAEDFMLWTVQCDLRLMQP
LLDLIFELCHIVFGLWPQCKHMENDIVRGWLRREERRPYRVGQFWYLITRDWWLSWMQYT
QHTAHTCDYCKRTANQRSAVDEALVCDESFNTHSLEQHDCYSLGSGTGSASGSGSASSGI
SAGRHCGPVRPGPIDNSNLITANPFRNVRTLTGEGGHLKRDTPLVQNHDFELVPKSLWKA
LNRWYGDNLPLPRQVIQPPNSDVELELYPLNLRILLHQVQPSQTGGGTQLGSWGSTVSGG
YGVLASGGGYAAIAASSVLQPPKRYLAYTAAFSRLATVRQVGEFLCEQLRLKSEDIRLWH
VPQLDNGAILLEEDAMCLKELLIRDNDQLLLEIRNKDLTWPEELGSLATAQSGQGAGTPG
DRRRLTRSSIMSVHAPGATGLHNLGNTCFMNAALQVLFNTQPLAQYFQREMHRFEVNAAN
KLGTKGQLAMRYAELLKEVWTATTRSVAPLKLRFCVNKYAPQFAGGGQHDSQELLEWLLD
ALHEDLNRVMEKPYSELKDSNGRPDKIVAAEAWSQHHARNQSIIIDLFYGQLKSKVSCLG
CGHESVRFDPFSLLSLPLPVENFIYFEVLVILLDGSVPIKYGFRLNSDCKYSHLKHKLST
MCSLPPNLMLVCELWNSQIRQVLADDEKLRTQSAKELYVYQLPEQSVRTRSNSGLSMHIE
QGLKDIQRSSALITSAQDSLSSLSTLQTSSHRASSRVLCNGHASSLEVEGEAEVGTDVSQ
CNSNSNSNYNPNVSTYSGIGSGDNQVHELLPDEAGKESLILSSSPENTFMHGAAAQQKCV
SSAKLLHTESNTSSMSYTNHSGENSMESSLTEPIPLAELEPASSRNGSGSDDCSYRTSLN
DSSGLSTGHTLGASLDVDEQAEEGNAEEHDQPDQITTSQPETSSGVYSRRSSQPPHKAGK
YLVAVHRKITRHDSYFLSYHKTRPSLFGVPLLIPNSEGGTHKDLYCAVWLQVSRLLSPLP
ATTEQANHAADCDDSLGYDFPFTLRAVKADGLTCAICPWSSFCRGCEIRCNNDYVLQGAL
PPINAAASNTSTPKMNAKFPSLPNLEAKRTPEYTASLSYTPTTKYFEDFTIAIDWDPTAL
HLRYQSTLERLWVDHETIAISRREQVEPVDLNHCLRAFTSEEKLEQWYHCSHCKGKKPAT
KKLQIWKLPPILIVHLKRFNCVNGKWVKSQKVVHFPFDDFDPTPYLASVPQETILRHKEL
LELKKDAEITMATNEVVSELDEIDAPSKEDKEDIRNQTVSNKATASPPPTGNILRQSKNK
NAARRQRLISTSLTKTPIVDGEFEDYHQHRLKPDMDEFDPRYRLYAVVSHSGMLNGGHYI
SYASNATGSWYCYNDSSCREISQKPVIDPSAAYLLFYERKGLDYEPYLPNIEGRTLPNTA
GVPLEVDETEGELKKLCSIS
NT seq 5283 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccaaggagtccaaacactccaatagcgtcagctacgaggattcggtgaagcgc
gtaagcgacgtggagcttcggcgcctgagagatgccttcaaaaagtcagctggcgtgggc
aggaacttcctcagtcggaatgcctttcagcaggatgtgctgtgcgagggagtgccgcca
aagatcgtggacatgttatatgccgcctgtggtggcacccagcgtggcatctccttcaat
gacctgctctgcggtctggtcttgataactcgaggtacccaagcggagaaaaccaaattc
ctgtggaacctctactgcaacgatgccggcaccttcatcatcaagtcggactatgtgcgc
aacgtcaatctggctccctttgagagcgtctccctcttcgcccaaagcgaacgcgtcaat
ttcgatcagttccaggactggatcataaagcatcgcaatgccacggttctctccaaatgg
ctgctggccgacaactgtgttagcctcacttcggagctggagacgccaacgttctaccag
agcctcgctggagtgacgcatcttgaggagaaggatatcggcgatctggaaaaggagttt
tggcgtttgaaaaacacttcccaaaatggccaaatcgacttgcagttccttggacccctg
atcagcccacccataccaaagaatgctctagcaggtctattcaacgcctttgatgagaac
cgcgacggacacatcgacttcaaggagttgtgttgcggagtaagtgccgcctgccgggga
ccaggtgtggaaaggacacgtttttgcttcaaaatcttcgatgtggatagagatggagtt
cttagtcacgaagaaacactgcagatgatcaatgttctgctgttagtagccaaggaaaat
cgagaggcccagcaatacaaggatctgaccaaacagctggtgataagtgatcttctggag
ttcggccagaggaggagtccggatggaacgcctagtaaactaacccgagacaatgtctcg
ctgaccgctgaggattttatgctgtggactgtacagtgtgatctgagactcatgcagccc
ttgcttgacctcatcttcgagctgtgtcacatcgtctttggcctgtggccccagtgcaag
cacatggagaacgatattgttcgcggatggctgcgacgggaggaacgcaggccgtaccgc
gtgggacagttctggtacttgattacgcgtgactggtggcttagttggatgcagtacacc
cagcacacggcacacacctgcgactattgcaagcgcactgccaaccagcggtccgctgtt
gatgaggcgctcgtctgcgatgagagcttcaacacccacagcctggaacagcacgattgc
tactccctgggttccggcacgggatcggcatccggttccgggtcggcgagtagtggcatc
tcagctggacggcattgcggacctgtgcgaccagggcctattgacaacagcaatctgatc
accgccaatccgttccggaatgttcgaactctcaccggcgagggtggtcacctcaagcgg
gacacacccttggtgcagaaccacgattttgaactggtgcccaagtcactgtggaaggca
ttgaatcgatggtatggcgacaatcttccattgccacgacaggtcattcaaccacccaac
tcagacgtcgaactagaactttacccgctgaacctgcgaatcctgctccaccaggtgcag
ccatcccagacaggcggaggcactcaactcggtagctggggttctacagtgagcggtggc
tatggagtcctggcatccggaggcggatatgccgccatcgccgcaagcagtgtactccaa
ccgccgaagcgatacttggcctacacggctgcctttagtcgactcgccacggtgcgccag
gtgggcgagtttttatgcgagcaattgcgtctcaagtcggaggacatacggctgtggcac
gttccacagctggacaacggtgccatattgctagaagaggatgccatgtgcctgaaagag
ctgctcattcgggacaacgaccagctgttgctggaaatccgcaacaaagatttgacctgg
ccggaggaactgggctccttggccaccgctcaaagtggccagggtgcgggaacaccgggg
gaccggcgtcgcctaacccgtagttcaattatgtcggtacatgcacccggagccactggc
ctgcacaacctgggtaacacgtgctttatgaacgccgccctccaggtgctgtttaatacc
caaccactggcacaatacttccagcgtgagatgcaccgtttcgaggtgaacgcggccaac
aaactgggcacaaagggccagttagctatgcgttatgcggagctgctcaaggaggtttgg
acggcaacgactagatctgtggcgccgctcaagctacgcttttgcgtcaacaagtatgcg
ccgcagttcgccggtggaggtcagcacgattctcaggagctgctcgagtggctgttggac
gctctgcatgaggaccttaaccgcgtgatggagaagccgtacagtgagctgaaggactca
aatgggcgcccagacaaaatagtcgccgccgaagcctggtcgcagcaccacgcccgcaac
cagtcaattatcattgatctgttctacggccagctgaaatccaaggtcagctgtttgggt
tgtggacacgaatcggtacgatttgatccgtttagtctactcagtttgccgctgccggta
gagaattttatctactttgaggtcttggtaattctgttggatggaagcgtgccaatcaaa
tatggttttcgcctgaactcggattgcaagtactcgcacctgaaacacaagttgtccacc
atgtgctccctgccgccaaatctaatgctcgtctgcgagctatggaactcacaaatacgc
caagtgctggccgacgacgagaaactgcggacgcagagtgccaaggagctgtacgtctat
cagctgccagaacaaagtgtgcgaacccgatccaactcaggacttagcatgcacatcgag
cagggtcttaaagacatacagcgcagttccgctctcatcacgagcgcccaggactcgctg
tcctcgctgagcactttgcaaacatccagtcaccgcgcctcgtcacgagtcctatgcaat
ggccacgcttctagcctggaggtcgaaggcgaggcggaggtgggaacggatgtgtcgcag
tgcaacagcaacagcaacagcaattacaatcccaacgtgagcacttacagcggaatcgga
agcggggacaaccaggtgcacgaactgctgccagatgaggccggaaaggagtcgcttatc
ctgagctccagtccggagaatacatttatgcacggcgctgccgcccagcagaagtgcgta
tcatccgccaaactgctgcacacggagagcaacactagctccatgtcctacacgaatcat
tccggcgaaaattctatggagagctcgctgacggaacccatcccattggcggagctggag
ccggccagcagccgtaatggaagtggcagcgatgactgctcctaccggacgtcgctgaac
gattccagtggccttagtactggccataccctgggcgccagtttggacgtagacgagcag
gcggaggagggtaacgcggaggagcacgatcagccggatcaaatcacaacctcgcagccg
gagaccagtagcggggtctactctcgtcgctcctcgcagccgccgcacaaggcgggcaag
tatttggtagccgtacatcgaaagataacgcggcacgacagctacttcctttcctaccac
aagacgaggccaagtctctttggcgttcccctgctcattccaaacagcgagggtggcacc
cacaaggatctatactgcgccgtgtggctgcaggtgagcaggctgctaagccccttgcct
gccaccacggaacaggcgaatcatgccgccgattgtgatgacagcctgggctatgatttc
ccctttacgttgcgtgctgttaaggcagatggactaacctgcgcgatttgcccttggtca
agcttctgtcgcggatgcgagattcgctgcaacaatgattatgtactccagggagccttg
ccgcccatcaatgccgccgcgagtaacacatcgacgccaaaaatgaatgctaaattccca
tcactaccaaatctggaggctaaacggacgccggaatataccgcctccctgtcgtacaca
ccgacaaccaaatactttgaagactttaccattgccatcgactgggatccgaccgccctg
cacttgcgctaccaaagtaccttggagcgtctgtgggtggatcacgagaccattgccata
agtcggcgggagcaagtggagcccgtggacctgaatcattgcctgcgcgccttcacctcc
gaggagaaactggagcagtggtatcactgcagtcattgcaagggcaagaaacccgctacc
aaaaaactccagatctggaaactgcctccgatattgattgttcacttgaagcggtttaac
tgcgtgaacggcaagtgggtcaagtcacagaaagtggtccactttcctttcgatgacttc
gatcccactccgtatctggcctcagtgcctcaggagacgatactgcggcacaaggagctg
ctggagctgaagaaggatgctgaaattacgatggcaaccaacgaagttgttagcgaattg
gacgagattgatgcacccagcaaggaggataaggaagacatccgcaatcaaacggtgtca
aataaggctaccgcgtcaccaccgcccacaggaaatattctgcgccagagcaagaacaaa
aatgctgcccggcgacaacgcctcatctcgacgagtctcaccaaaacgcctatcgtggat
ggcgaattcgaagactaccaccaacaccgacttaaaccagatatggatgagttcgatccc
agataccgactctatgctgttgtgtctcactcgggtatgctgaacggaggtcattacatt
tcctatgcatcgaatgcaactggttcctggtactgctacaacgacagctcctgccgcgaa
atatcccagaagccggtcattgatccaagtgctgcatatctgctgttctacgaacgcaag
ggcctggactacgaaccatatctgccgaacatcgagggacggacgctgcccaataccgct
ggtgtgccactcgaggtggacgagaccgagggagagctgaagaagctgtgctcaatttcc
taa

DBGET integrated database retrieval system