KEGG   Drosophila erecta: Dere_GG16105Help
Entry
Dere_GG16105      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein, isoform A
Organism
der  Drosophila erecta
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase Abhydrolase_6
Motif
Other DBs
NCBI-GeneID: 6544548
NCBI-ProteinID: XP_001973470
FlyBase: FBgn0108340
UniProt: B3NIK0
Position
Unknown
AA seq 376 aa AA seqDB search
MRILCAIVILLRLGALGDIAADEKGKSTRSWWDSVPRLLTDIVTIKANILTATPLELASN
VIDAVCSSTLFMDRIPPQITPDIRKMHFQYMTPCQNYSVPLLEASKLWKHSRFSKGRKVV
ILATGWTNTVNESSAISMISKAFMCRGDVNFVIVDAADYVDTLYSWSALNTDLIGEHIGV
GLTHLIELTPLRNIHLIGHSLGAHIMGTAGRTFTKLTGKLIPRITGLDPAKPCFRRENIL
PGLTRGDAKLVDIIHTNIGILAKRGPLGDVDFYPGGAHPFQPGCLTIGCSHTRAVEYFAE
SAYPHQEKNFIGNKCASWDKLRKRDCSAGKISPMGYKINRQARGIYYVDVNSWPPYGRNS
RETIDQRLKTCYLCQE
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcggattttgtgtgcaattgttatcctcttacgcctcggagcactcggagatatagct
gcagatgaaaagggcaagtcgacgaggagttggtgggattcagtgccccgacttttgact
gacatcgttaccattaaggcgaacatactcacagctactccacttgaattggcctccaac
gtaattgatgctgtgtgctcctccaccctctttatggacagaatccctccgcaaatcact
ccggacataaggaagatgcattttcagtatatgacgccctgccagaactacagtgtgcct
ctgctggaggcctcgaagctgtggaagcactctaggttcagcaaaggacgcaaggtggtc
attttggccaccggatggacaaacaccgtaaacgaatcctcggccatttcgatgatctcc
aaggcattcatgtgtcgtggcgatgtgaattttgtgattgtagatgcagctgactatgtg
gacaccctctactcctggtcggcgctgaacacggatttaattggcgagcatattggagtt
ggtctgacccaccttatagagctgaccccacttcgcaatattcacttaattggacattca
ctgggagctcacattatgggcactgctggtcgcacttttacgaagcttacaggaaaactt
atccccaggataactggcttggatccggccaaaccctgtttcaggcgggaaaatatcctg
ccaggactaacgcgaggcgatgccaagctagtggacataatccatacaaacattggtatt
ctcgccaagcgtggaccccttggggatgtggacttttatcccggtggagcacatcccttc
cagccgggctgcctaaccatcgggtgctcccataccagagcggttgagtatttcgccgag
agtgcatatccacaccaggagaagaacttcataggcaacaagtgcgcttcttgggataag
ctcagaaaacgggattgttctgctggcaaaatttccccgatgggctataaaattaatcgg
caagccaggggcatttactacgtagatgttaatagctggcctccttacggccgaaactcg
agagaaacaattgatcagagattaaaaacgtgctatctatgccaggagtga

DBGET integrated database retrieval system