KEGG   Drosophila erecta: Dere_GG16161Help
Entry
Dere_GG16161      CDS       T01060                                 

Definition
GG16161 gene product from transcript GG16161-RA
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
der  Drosophila erecta
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dere_GG16161
Enzymes [BR:der01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Dere_GG16161
Peptidases [BR:der01002]
 Cysteine Peptidases
  Family C44
   Dere_GG16161
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 558 aa AA seqDB search
MCGIFSIFSKDGEPIPTQIIHGSKHSLRELAYRQSGKQRHRGPDSTGVYVIPSDGVAMVH
ERLRIVGVEMGDQPFVSDDGNLILVANGEIYNYFEISAEIAKKRGSYSPKSDCHVILELY
QDYGKDLLHYITGMFAFALYDRKTKEVLIARDPFGIIPMYVGEDASGNLWVASEMKCLVD
TCSKVETFTPGEARFGKVGDLKTCWQFQESWIREVPTQTCDLALLRANLESAVRSHLQCD
VHLGALLSGGVDSSLIASIATKIMRERDPNFRLKTFSVGLKDAPDFQAARSVAKYINSDH
KEIIFEIDEALDGIRDIVYHLETYDVTTVRCSLPMLLLARYIKSTGIKMILSGEGADEIF
GGYLYFHKAPGYKDFHEELVKRVRQLHLSDCLRANKVAMAKGVELRVPFLDTGFVNHVMQ
IRPEDKIPGPLNKFGEEQKKRLEKYVLRAAFADNYLPDEVLWRQKEQFSDGVGYDWIDSI
RRVATSHVSDEEFAGAVLRFPFNTPTTKEAFYYRCIFAEQFPGESAARTVVRWVPRLDWG
CPEDPSGRAQAVHQFNED
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattttttcaatattttcgaaggatggggagccgatacccacgcaaatcatc
cacggcagcaaacacagtctaagggaactggcctatcgacagagtggaaagcagcggcat
cgtggtccggattccacaggcgtctatgtgattccctcggacggagtggccatggttcat
gaacgcctgcgaattgtgggcgtggaaatgggcgatcagcccttcgtctctgatgatggc
aacctcatcctggtggccaacggagagatctacaactattttgagatttcggctgagatt
gcaaaaaaacgtggctcctacagcccgaagagcgattgccacgtgatactggaactgtac
caggattacggaaaggatcttctgcattacatcaccggcatgtttgcttttgccttgtac
gataggaagaccaaggaagtccttattgcccgagatccctttggcattatacccatgtat
gtgggtgaggatgcgtcgggaaacctttgggtggcctcggagatgaagtgcctggtggat
acctgctctaaggtggagactttcacacctggcgaggctcgattcggtaaagttggtgac
cttaaaacatgctggcagtttcaagagtcttggatcagggaggtgcccacccaaacctgc
gatttggccctactgcgagccaacttggagtctgcggtgcgaagtcatctgcagtgcgat
gttcatctgggagctctgctgtccggcggagtggattccagtcttatagcctccatagcc
acgaagataatgcgcgaaagggatcccaacttccgactgaaaaccttctctgtgggtctg
aaggatgcgcccgacttccaggcggccaggagtgtggccaaatatataaacagcgatcac
aaggaaattatattcgagatcgacgaagctctggatggcattagggatattgtctatcac
ttggaaacctatgatgtgaccacagtgagatgtagtttgcccatgctgttactggctaga
tatataaagagcaccggcatcaagatgatcctctccggcgaaggagccgatgagatcttt
ggtgggtatttatacttccacaaggccccaggctataaggatttccacgaggagctggtg
aagagagtgcgccagctgcatttatccgattgcttgcgggccaacaaggtagccatggcc
aagggagtggagctgcgagtgccctttctggacacgggctttgttaaccatgtgatgcaa
atccgaccggaggataagatccccgggcccctcaacaaattcggggaagaacagaaaaag
cgattggaaaagtatgtcctgcgagccgcctttgcggataactatctgcccgatgaagtc
ctctggcgccaaaaggaacagttctccgacggggtgggatacgattggatcgacagcatc
cgcagggtggccaccagccatgtcagcgatgaagaattcgccggagccgtcctacggttt
cctttcaacacgcccaccaccaaggaggccttctactatcgctgcattttcgccgaacaa
ttccccggagaatcggcagcccgaaccgtagtcagatgggtgccacgcctcgattggggc
tgtccggaggatccatccggacgggcacaggccgtccaccaattcaacgaagactga

DBGET integrated database retrieval system