KEGG   Drosophila erecta: Dere_GG16226Help
Entry
Dere_GG16226      CDS       T01060                                 

Definition
GG16226 gene product from transcript GG16226-RA
Orthology
K06634  
cyclin H
Organism
der  Drosophila erecta
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:der00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    Dere_GG16226
  Replication and repair
   03420 Nucleotide excision repair
    Dere_GG16226
Transcription machinery [BR:der03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     Dere_GG16226
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 324 aa AA seqDB search
MYPVSSQKRSWTFANEGQLMDFRVEQNSKYIESHEEEAQGLDLKEHFLTPAEERLLLKQY
EIYLFDFCRRFDPPMPKCVVGTAFHYFKRFYLNNTPMDYHPKEILATCVFVACKVEEFNV
SINQFVNNIKGDRNKATDIVLSNELLLIGQLNYYLTIHNPFRPIEGLLIDIKTRSNMQHP
ERLRPHIDSFIDSTFYSDACLLHTPSQIALAAVLHAASREQENLDSYVTDLLFVSAREKL
PGLIDAVRKIRIMVKQYQQPDRDKVKAIEKKLDKCRNQANNPDSELYKERLRRLYTDEDD
MPAEDASFHIADVSSDTSAMNISQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtatcctgtgagctctcagaagaggtcatggacgttcgccaacgagggccagctcatg
gacttccgcgtagagcagaacagcaagtacatcgagtcgcacgaggaggaggcgcagggt
ctcgaccttaaagagcacttccttacgcccgcggaggagcgcctgttgctgaagcagtac
gagatctacctcttcgacttctgccgccgcttcgatccgccgatgcccaagtgcgtggtg
ggcacggccttccactacttcaagcggttctatctgaacaacacccccatggactatcat
cccaaggagattctagccacatgcgtgtttgttgcctgcaaagtggaggaattcaacgtg
tccatcaaccagttcgtcaacaacatcaagggcgacaggaataaggccacagacatagtg
ttatccaatgaattactgctgattggacagctcaactactacctcaccatacacaatccg
ttcagacccatcgaggggcttctaatagatataaaaactcgcagcaatatgcaacatcct
gagcgtctgcggccacatattgatagttttatcgattccacattctactcggatgcctgt
cttttgcatacgccctcgcaaatcgcattagctgccgtcctccacgctgccagcagagaa
caagagaatcttgatagctatgtgacggatcttctttttgtctccgccagggagaagcta
cccggcctcatagatgccgtgagaaaaattcgaataatggtgaagcaatatcagcagccc
gatcgggataaagttaaggccattgagaagaagttggataagtgccgcaatcaagcaaat
aatcctgacagcgaactctataaggagcgcctacgccgattgtacaccgacgaggatgac
atgcctgccgaagatgcctcattccacattgcagacgtgagctcggatacatctgctatg
aacataagccaatag

DBGET integrated database retrieval system