KEGG   Drosophila erecta: Dere_GG16226Help
Entry
Dere_GG16226      CDS       T01060                                 

Definition
GG16226 gene product from transcript GG16226-RA
Orthology
K06634  
cyclin H
Organism
der  Drosophila erecta
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:der03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:der03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 324 aa AA seqDB search
MYPVSSQKRSWTFANEGQLMDFRVEQNSKYIESHEEEAQGLDLKEHFLTPAEERLLLKQY
EIYLFDFCRRFDPPMPKCVVGTAFHYFKRFYLNNTPMDYHPKEILATCVFVACKVEEFNV
SINQFVNNIKGDRNKATDIVLSNELLLIGQLNYYLTIHNPFRPIEGLLIDIKTRSNMQHP
ERLRPHIDSFIDSTFYSDACLLHTPSQIALAAVLHAASREQENLDSYVTDLLFVSAREKL
PGLIDAVRKIRIMVKQYQQPDRDKVKAIEKKLDKCRNQANNPDSELYKERLRRLYTDEDD
MPAEDASFHIADVSSDTSAMNISQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtatcctgtgagctctcagaagaggtcatggacgttcgccaacgagggccagctcatg
gacttccgcgtagagcagaacagcaagtacatcgagtcgcacgaggaggaggcgcagggt
ctcgaccttaaagagcacttccttacgcccgcggaggagcgcctgttgctgaagcagtac
gagatctacctcttcgacttctgccgccgcttcgatccgccgatgcccaagtgcgtggtg
ggcacggccttccactacttcaagcggttctatctgaacaacacccccatggactatcat
cccaaggagattctagccacatgcgtgtttgttgcctgcaaagtggaggaattcaacgtg
tccatcaaccagttcgtcaacaacatcaagggcgacaggaataaggccacagacatagtg
ttatccaatgaattactgctgattggacagctcaactactacctcaccatacacaatccg
ttcagacccatcgaggggcttctaatagatataaaaactcgcagcaatatgcaacatcct
gagcgtctgcggccacatattgatagttttatcgattccacattctactcggatgcctgt
cttttgcatacgccctcgcaaatcgcattagctgccgtcctccacgctgccagcagagaa
caagagaatcttgatagctatgtgacggatcttctttttgtctccgccagggagaagcta
cccggcctcatagatgccgtgagaaaaattcgaataatggtgaagcaatatcagcagccc
gatcgggataaagttaaggccattgagaagaagttggataagtgccgcaatcaagcaaat
aatcctgacagcgaactctataaggagcgcctacgccgattgtacaccgacgaggatgac
atgcctgccgaagatgcctcattccacattgcagacgtgagctcggatacatctgctatg
aacataagccaatag

DBGET integrated database retrieval system