KEGG   Drosophila erecta: Dere_GG16414Help
Entry
Dere_GG16414      CDS       T01060                                 

Definition
GG16414 gene product from transcript GG16414-RA
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
der  Drosophila erecta
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 837 aa AA seqDB search
MVGSQEKKKNHIELSGTAAINKNSVYTAENNLNTTPLENLKISKALSPPSSLPQIKIPMI
NQNSTHTGIAQTNLEKSSRHSYRGSGLQYFSSSFEPPAMLDDNNEDLPKQPSNNIANYPG
DVQILPMFDCCRSESIQAVSLPNVTSTSKKTDVPGLYLSTISESSKSKLEPECKPLVLVK
ESSVMENHTFLFHEQIIMSGQEKCELHEKPKVLVVSPQQVMILYMNKLTPYERTEILTYP
QIYFIGANAKKRPGVYGPNNSEYDNEQGAYIHVPHDHVAYRYEMLKIIGKGSFGQVIKAY
DHKTHEHVALKIVRNEKRFHRQAQEEIRILHHLRRHDKYNTMNIIHMFDYFTFRNHTCIT
FELLSINLYELIKKNGFKGFSLQLVRKFAHSLLQCLDALYKNDIIHCDMKPENVLLKQQG
RSGIKVIDFGSSCFENQRIYTYIQSRFYRAPEVILGAKYGRAIDMWSLGCILAELLSGHA
LFPGENESDQLACIIEVLGMPNKNILASSKRSKSFFSPKGYPRYCTVRTMSDGMVVLIGG
QSRRGKQRGPPCSKSLSKALDGCKDPLFLNFIRGCLEWDADKRLTPSEALKHPWLRRRLP
RPPSSSSGCGGVSGLSVSRNESPVTGQNRNFAAEITTSSTSATSISLTIKRDNSHSSLRI
HHGGVPETDFKLIKSVPEGSSTATIEPMMNTDILVESFRQTTVVSPRIPSMHSADSGGIS
CLSAVDVGPSRYYPYMNNNENNRLFSGSLNSSANSLTHLEQATNLDAVGEYSASTTQNLL
SKNNGYAFNSCSMTIDVAQESLVNIASNYALDKSNDIIGKSNGSLHSNKLKVQSKDM
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atggtcggttctcaagaaaaaaaaaaaaatcatatcgaattatctggaacagccgcgata
aacaaaaatagcgtatatacagctgaaaataatctaaacacaactcctctggaaaacctt
aaaatttcaaaagcactttcacctccttcatcactacctcagattaaaattccgatgatt
aaccaaaattccacacatactggtatcgctcaaactaatcttgaaaagtcaagccgtcat
tcataccggggcagtggactgcaatatttcagcagtagctttgaaccaccggcaatgctt
gatgataataatgaagacttgcccaaacagccatcaaataatattgccaattatcctgga
gatgttcaaattttacccatgttcgattgctgccgttcggagtctattcaagcagtatcg
ttgcctaatgtaacatcaacttcaaagaaaacagatgttcctgggttgtatttaagtacg
atttcagaaagttctaaatcaaaattggaacccgaatgtaaaccgctagttttagtcaaa
gaatcttcagtaatggaaaaccacacctttttatttcacgagcaaattatcatgtctggc
caagaaaaatgcgaattacacgagaaaccaaaggtactggtcgtttccccacaacaagta
atgattttatatatgaataaattaaccccctacgaacgaacagaaatactaacttatccg
cagatatattttattggcgccaacgcgaagaagcgccctggggtctatggcccaaataat
tctgaatacgacaatgaacaaggcgcttacattcatgtaccgcatgatcacgtggcatat
cggtatgaaatgctaaagataatcggaaaaggtagctttgggcaggttattaaagcgtat
gatcataaaactcacgagcatgttgccttaaaaatagtgcgcaatgaaaaacggtttcac
cgtcaggcccaagaggaaattcgcattcttcatcatttacgccgtcacgataaatataat
actatgaacatcatacacatgtttgattactttactttccgcaatcatacctgtattaca
tttgagctgctcagcattaatctttacgaattaattaaaaaaaatggatttaaaggcttc
agtttgcaactggtacgaaagtttgcacactctttgctacaatgtttggatgcactttat
aaaaatgacatcattcattgcgatatgaaaccagaaaatgtgctactgaagcaacaagga
cgttctggtataaaggtaattgactttgggtcgtcatgctttgaaaaccagcgtatatac
acatatatccagtcacgtttttatcgcgctccagaggtaattttgggggcaaaatatggc
agagctatcgacatgtggtcgttgggttgtattttagcagagctgctttcagggcatgca
ttgtttcctggtgaaaacgaaagcgatcagttggcttgcattattgaagttttaggaatg
cccaacaaaaatatactagccagctcgaagaggtcaaaatcgtttttcagcccaaagggt
tatcctcgatattgtacggttcgaacaatgtctgatggaatggtggtcctaatcggcgga
cagtcacgtcgtggcaaacaaaggggcccgccatgctcaaaaagtctatccaaagcactg
gatggatgcaaagatcccctctttcttaattttatacgtggttgccttgaatgggatgca
gataagcgattaactccttccgaggctctaaaacatccatggcttcgccgtcgcttaccg
agaccgccaagtagctcaagtggttgtggtggggtgagtggcttaagtgttagtaggaac
gaatccccagttacaggacaaaataggaactttgcagccgaaataactacatcatcaacg
tctgccacatctatatctttaacgattaaaagggataacagtcattccagtcttcgtatt
caccatggtggtgttccagaaacagacttcaaacttataaagtccgttccagaaggatca
tcaaccgcaactatagaaccaatgatgaacactgatattctagtagaaagttttagacaa
acaacagttgtatcaccacgtataccatcaatgcattctgctgactccggcggaataagt
tgtcttagcgcagtggatgtcgggccttcgagatattatccgtatatgaataacaatgaa
aataacagattattctcaggctcgttaaacagctcggcaaactcattgacacatttggaa
caagccacaaacttagatgctgtgggagaatactcggcgtcaaccacacaaaatttacta
tcgaaaaataatggctacgcgtttaactcatgttctatgaccatagatgttgcacaagag
tctttggttaatatagctagcaattacgccttggataaatctaacgacattattggaaaa
tcaaatggttcgcttcattcgaataaattaaaagtacaatcaaaagatatgtag

DBGET integrated database retrieval system