KEGG   Drosophila erecta: Dere_GG16430Help
Entry
Dere_GG16430      CDS       T01060                                 

Definition
GG16430 gene product from transcript GG16430-RA
Orthology
K15293  
protein unc-13
Organism
der  Drosophila erecta
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1654 aa AA seqDB search
HYARHDYFHNTQNGALSSDTGRISYSRISYETQTNKEYFSEPYALSNQGPEEYSRGYHLN
SDTVPTTIDKSNNSYDYDYLECYGADIQCDPEEDSVDNWNENTSVAADQYGFEHENLKCT
SSKLLPKLPNNKNVSGSSNACAPQMETKFKKEGTCIKRDHSYGVCMAKAHDFDGRLSPSN
YQNILGNNLNGYAGCVYSSTVLDNAVSAAPLRVLPQSARSSFYLGRDIIGFNTDAAQRDG
CGFGMDQAVAMGSGSSTYEVYEKIPRPYTSMLPLDYSYYQECCNNTDNLSTYSDTPPSNN
AQLKRQNQRKISLMMAMTTASVIASGEIRVPVHSKQSKKSTEIQTDSLIGSTISTNAAAR
DLNRCLAAEPCGVFDSGSVTNFPSTAVTTISKTRKLPKVLPTPLYKSSRHPITIDTDELN
SSLYTSDPLPEKSHRPKQLPKLPKPLSQTKDHSSLDSNWTTLPVPDALTFDSLEQKSPPS
PTTTTTITKEKETISYLSRTASIGARHNNLLYSYDSKEPNKAFLDKYVEAEPSPSWTPSS
PIQSKQSLSPPVSLPSNSCHKVSLTCHLPEIETARSDIESAVNDLVIEPIPESEKSADPY
SGPDSALFNISEYLKPYTLDIINFSGEKKNHITNAASTSTATLPYNDNGEIISKLAKTPL
TKKPDDEFSSYSNMWTSSCVNFQPFDVESSLNISVKANACMYQAELLMTPLEGSTPPLIC
SNVTSDNLISSKSSPPDSAFTTTVYDNNSETVPASTSENASPSPSILKSPPSIAPILSYA
DYMKQFQLPELPQPIMDLSENDPATQSVSINVIPNNLTNADNLNSYKQVDVTSKSSVPLP
SYSSESFDPSSVPSLSIKNKDSPPNVETVDSAQITTLVSLADPLNCLKLLPGTELIESNA
VSFDDTFYDSFNVDIKELTAFVDHAAPAEDGNFPKDKTLIEFSFDKTVDTIDMNQNLSSG
QCGYYKPSQAHQKSSVVASAATSVLGGISKGFKEGLDGVFSGVSSTVEVTHTNTSSKRGF
SFNLASKIVPSVGGLLTSSSSTSIKQTGTETTPNIIMISSENVSSDYIPTPSPSCTPKNG
DENLYAATVPNMSNSYYDDVEEISTTLVRNVCDNYDNIYDEMILTDEMVNVGVLNSESDF
GLIDSYQVSGREQIDSANTYNNTQNVPKDGIEEANIKSKPVHFHDPTTKKASTTSVGMFG
SILGKAAAAVQSATQAVNQGASSVASAVVAQKPTIVPTTKKVLLYDVSSPNEIKQGSGSV
EFDSMNIDYRYQSPNVESLSSHYGNTGDDYDNSNMKMHEFSTYADDRVYADYHSNGNQSQ
FKDGPVIPGQTQVIGTNILPTVPLTAGKKLPTVNGKSPLLIKQTPTEVYDDESELGELDA
SSSTGKVPSYRIYSEQEEKYYMDLQQTTPSIQPNGFYEQVNNGYDYREDYFNEEDEYKYL
EQQREQEQQNLSKNKKYLKQAKSMLSNRQPPSLDFIDVGQDDDFMYDNYHSEDDSGNYIE
GSSSGSVGPMDGSNTKVDSNGETSYASITKKSDFITLTNNSFQKHDTVTGESRFSTEITC
PDVDEKDENLNDNLSDLTDLSKRISQKKKPLLRGETEEVVGGHMQVIRQPEITARQRWHW
AYNKIIMQLNVSALYIFFKYFIANLNYPSIDNKL
NT seq 4965 nt NT seq  +upstreamnt  +downstreamnt
cactacgcaaggcatgattactttcataacacccaaaacggtgccttatcctctgacacc
ggccgaatatcttatagtcgaatttcttacgaaacacagacgaacaaagaatattttagc
gagccatatgctttaagcaatcaaggaccagaagaatacagtcgtgggtaccacctaaac
agtgatacagtacctacaaccatagacaaaagcaacaatagttatgactacgactactta
gaatgttatggagctgatatccagtgtgatccggaagaggattctgttgacaattggaac
gaaaacacttcggttgctgcagatcaatatggatttgaacatgaaaatctaaaatgtacc
tcatcgaaattattgcctaagctgccaaataataaaaatgtaagcgggtcatcaaacgca
tgtgcccctcagatggaaacaaagtttaaaaaagaaggtacgtgcataaaaagagaccac
agctatggtgtctgcatggccaaggcacacgacttcgacggtcgtctttcgcctagtaac
taccagaatatccttggcaataatctcaatggatatgctggttgtgtctactcttcgaca
gtcctagacaatgctgtgtcagcggcaccattgcgggttttaccgcaatcagcgcggtct
agcttttatttaggtcgagatataattggatttaatacagacgcggctcagagggatgga
tgcggcttcggcatggatcaagctgttgcgatgggctctggatctagtacatatgaagtt
tatgaaaaaattccaaggccatacacatccatgttgccgttagattacagttattaccaa
gaatgttgtaacaataccgacaatctatcaacatacagcgacacaccgccaagcaataat
gcacaactaaagcggcaaaatcaaaggaagatttcgttaatgatggcgatgactacagct
tctgtgatagcatctggtgagattagagtcccagttcactcaaagcaatctaagaaatct
actgaaattcaaacagactctctgataggaagcaccatcagtaccaatgcagctgcaaga
gacttaaacagatgtttggcggcggaaccttgtggtgtatttgactctggtagcgtcaca
aatttcccatctactgctgtgacaacaatatcaaagactagaaaattaccaaaggtttta
ccaacgccactgtacaaatcatctcgtcatccaatcaccatagacaccgatgaattaaat
tcatcattatatacttcagatcctttaccagagaaaagtcatcgcccaaagcagctgccc
aagctgccaaaaccattatcccagaccaaagatcattcaagcctcgattcgaattggacg
accttacctgtcccagatgcattaacatttgattcgttggaacagaaatcgcccccttct
ccaacgacaacaacaacaataacaaaggaaaaagaaaccatctcatacctgtctagaaca
gcttcaattggtgccaggcataataaccttctttattcctatgatagtaaagaaccaaat
aaagcatttttggacaagtatgtcgaagcagaaccatcgccatcatggaccccatcatcg
ccaatacaatcaaaacaaagtcttagtccacctgtgtcgcttccaagcaatagttgtcat
aaagtttcactaacatgtcacttacctgaaatcgagacagcccgatctgatatagagtca
gccgtaaatgaccttgtcatcgaaccgattccagaaagtgaaaaatcagccgacccatat
agcgggcccgattcagccttatttaacatatctgagtatctaaagccttatacattagat
ataataaatttttccggagaaaaaaaaaatcatatcaccaatgctgccagtacgtcaacc
gcaactcttccttacaacgataatggggagatcataagtaaattggctaaaacgccattg
actaaaaaaccagatgacgaattttcttcatattctaacatgtggacgagtagttgcgtt
aattttcaaccatttgacgttgaatcgagtttaaatatttcagtcaaagcaaacgcttgc
atgtatcaggccgaattattaatgacaccattagaaggttccactcctcctttaatttgt
tctaatgtcacatctgataatttaatttcaagcaaaagttctcctcccgacagtgcgttc
acaacaactgtttacgacaacaattctgaaacggtaccagcatcaacaagcgaaaatgct
tcaccgtcgccgtcaatcttaaagtcaccaccatcaatagctccaattctttcctacgcg
gattacatgaaacaatttcagttaccagaattgccgcaaccaattatggatctttcagaa
aatgaccctgctactcaaagcgtttccattaatgttatccctaataatcttactaacgct
gacaatttaaattcgtacaaacaggtggatgtaacaagcaaaagtagtgtaccattacct
tcttattccagtgaatcatttgatccaagtagtgtgcctagcctttcaattaagaataaa
gacagtccaccaaatgttgaaaccgtagattcagcacaaattacaaccttagtaagttta
gcagacccattgaattgcttaaaattattaccagggacggaattaatagagagcaatgct
gtatcgtttgatgataccttttatgatagttttaatgttgacataaaagagctgacggca
tttgttgaccatgctgcccccgcagaagatggtaatttcccaaaagataagactttaatt
gaattcagttttgataagaccgtagatacaatagacatgaatcagaatttgagctcagga
caatgcggttattataagccatctcaggcacaccaaaaatcaagtgtagtagcatctgca
gcaactagtgttcttggcggaatttcaaagggcttcaaggaaggactggacggcgttttt
agtggtgtcagttcaacagttgaagttactcacacaaataccagttccaaaaggggtttt
agctttaacttggcatcaaagattgtaccaagtgtcggtggattgcttactagttcaagt
tctacctccattaaacaaacaggaacagaaacgactcctaacataattatgatatcatct
gaaaatgtttctagtgattatatacctacgccatctccatcgtgcactccaaaaaatggc
gatgaaaatttatacgcggctacagttcccaacatgtcaaattcttattatgatgatgtg
gaagaaattagtacgaccttagtaagaaatgtttgtgacaattacgataatatctatgat
gagatgattttaaccgacgaaatggttaatgttggggtgcttaacagtgaatctgatttt
ggcttaatagattcgtaccaggtatcaggcagagaacagatcgacagtgctaacacgtat
aataatacccaaaatgtaccaaaagatggcatagaagaagcaaatataaaaagtaaacca
gtgcattttcatgatcctacgacgaagaaagcaagtactacatctgttggcatgttcgga
tcaattttaggaaaagccgctgcagcagtgcaatcagcaacgcaagctgtcaatcaaggt
gcatcctctgtggcatcagcagtcgtggcacaaaagccaacaatcgtaccgacaacgaaa
aaagtacttttgtacgatgtgtcctcacctaatgagattaaacaaggctcaggttcagtt
gaattcgattcaatgaatatcgattacagatatcaatcgcccaatgtagaatctctgtca
agccattacggaaatactggcgatgattatgataatagtaatatgaaaatgcatgaattt
agtacatatgcagatgatagggtatacgccgattaccattcgaatggcaatcaaagccag
tttaaagatggcccggtgatacctgggcaaacgcaagtaattggaacaaacatactcccg
actgtcccgctaaccgccggcaaaaaactgcctaccgtgaatggtaagtcgccgttgcta
attaagcagacgcctactgaggtatatgacgatgaatcagaattaggtgaattagatgcc
agttcatcaacaggaaaagtacctagttatcgtatttatagtgagcaggaagaaaaatac
tacatggatcttcagcaaacgacaccgtcgattcagccaaacggtttttatgaacaagtc
aataatggctatgactatcgagaggattactttaacgaggaggatgaatataagtatctc
gagcagcagagggagcaagagcagcagaatctgtcaaaaaacaagaaatatctaaagcag
gccaaaagtatgctatcaaacagacaaccaccatcattagatttcattgacgtaggacaa
gacgatgactttatgtacgacaactatcacagcgaagacgacagcggaaattatatagag
ggtagctccagtggtagcgttggtcctatggatgggtcaaatacaaaggtggactcgaac
ggagagacttcgtatgcttcaatcaccaagaagagtgacttcattacactgacaaacaat
tcctttcaaaagcatgacaccgttactggtgaatcgcgctttagcacagaaataacgtgt
ccagacgtggacgaaaaagatgaaaacttaaacgataacctttctgatcttactgactta
agtaaacgaatctcgcaaaaaaaaaaaccgcttttgaggggagaaactgaagaagtcgta
ggtggacacatgcaggtgatacgtcaaccggaaatcacagctcggcaacgatggcattgg
gcatacaacaaaataatcatgcagcttaatgtaagtgcgttatatatattttttaaatat
tttatagcaaacctaaattaccctagtatagacaataagttgtag

DBGET integrated database retrieval system