KEGG   Drosophila erecta: Dere_GG16431Help
Entry
Dere_GG16431      CDS       T01060                                 

Definition
GG16431 gene product from transcript GG16431-RA
Orthology
K15293  
protein unc-13
Organism
der  Drosophila erecta
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 2053 aa AA seqDB search
MMNTSQLQATGDPEKKSQLFKKDLKMNTQEKLIFAENALKSQIEIKEQLRLQQQSTMYAS
SLLSTSAGGSVREPLLNQRHLNSVQYNKKFDRAHTQIPQRQPTMSNSPVGLDSTYLSYPS
TNTHGSMISIKSEQQLCQIYNSQQHSDYIISDYMDKIATRISLLETELKFAWRALDLLST
EYGKIWIRLEKLENISIEQQSVVGNLMDLIGASKQELHEVDMERMEVPLYQEEDQLLPLV
MEDTLDINIKPSDHDYDKNLTFENHNTFVTELTHGTESDEFINSACAIDSNPNFENVTLN
DKSLEIGIIKFDFDKGYERNQKGIQSDFEASHKKSRIQLYSDSDLMLYERQQFLANSARA
ELMKEFLNGRRVLNEISASSGALSKISKKGTDPVQPSEPLISDQSQFEIDDKYVRQTSNE
LDSLIGDKFFRLAASKTGEGDTQVLPIEDTGGTESPANMNEVDESFYKKLNEAYRDNELS
SEIFKVDALLHQSGATHDQIASIRNNSASSHVLNNQGVKDITDIQSLQTEKTSLVTQANQ
NSNKESRKHRKKKHHTNEMDMINKLKCILAQAQSTQINKEDSEELDSKLSGPVGKLTGTE
GTTLQNESDKHSSTRYLRDDIRKILNNVIQTLLEEINKITGLQSLSASQINQLRNAVWSE
EKFFQKISQVDKKLTLLLLNPLTVTEELQRLSISNTNEKFVLVMKKLKKNIDTLKKLVGS
SLDDFKIDNSHANTTTSQSLNSSLNSNVTSFSAHLLRNNSNLDEQLKILETQEIEIHRKN
KIDQIVSGLSEEADTLNPNIEYKNYNSCTNSTDNILSFSKNIYNEDEYIKSLKKSLERHN
SMIFLLHLQNPEKHKVLADINDALIDSNRASLSPPPPAPTDTINLNEAINQISYQQRNAK
SDSGLSSMSGWSPNSQVSVGIQNYDFVCNNILENCSEGLQSYHSLHLSENSNIHSLPVSY
ERAQTNNQNELVILEENLNYIYELSKNLPICSAYENKSIFDMNCDSNEIRKFSTVDEMLE
WDQLNEPDKQNFSVKRINSNLMPDLLTAQIQNSVSKHNKNTYSSIEYAGQKENGSLTRRS
IIEPSIYNGESLNQSCRPCLTDRLVFYPSSNSITDHNSSHNLNYLGKQDKTRIRECGSTP
SNQDPTNYLDYTPGSYSKGKPEVLTAATNYSQLEFKVESESLLNSPNISSYCKQKRIVQG
TSPAKPSKVWNRLNTILTHNLKLKRALKFNRSQSLPGDMQSQDVQRQPRGQAGSCPFISH
KRSNLGGSQVQLSKRIQKLPMRFIRQATGATFVRHLSSPDSAVSLDSAADERFSSERSLQ
KKSLSSKMNSLMQKAKKYKRHNIVLRRGCNMSDSELETTDFVSSDNDKSLISESEILLNQ
SVDVEDEREENFYDKNGCDFDYKSELGGSIEKLNGNPPNNLFAIVGDLKKIQSPIPLAVS
TEIPLFEHENSNESENHKNSPIEMPKILLETPLQSCHQELNSAHSDDEVVKNLLGNSVEN
NVNAPTLNILNTIDPMMTTFLTTTMTATTTNSSRNLNGTSALWVTQQCLDLPNISGCGSR
EDDDNRSQYSARTLSSSRRQSTEDSIDTDDEYFYYELRQLEEQEKQRAQTSAIASSERQD
DNGVLFSQIGQLLQNDVNGEVCFNPSDVCKDEEDAIIYSPSESVKLRMSEVFNELKSVVS
LVPGVYDDSEVFAVSVATIEGNSIVKPTCEKLATVSDMHSAWQDVNGDLQITASEIDFND
DLIANKGRETLIYLNNKQRKLRRLKKKTRDRKINISNNAASSSSSCQSENDCEQHERNTP
LGKYTQKSDAEKAENDISNKSDASSETSGPDTPAELSDVEISETENGVRTDGQNIDNMHE
NSAALLKVNRKTLCNDHDLKNQSLETYQYNTQILKNITSKSLPTQNQIDSKKLNSQESDA
DGSQAIGNEIAAGLSSSKWKLLKTLKERKIEEKNNQDKIKEDEMTKDRDKNGGGTGEAGL
RTNGHPGDNPFYSNIDSMPDIRPRRKSIPLVSELVLKTMAATKRNAGLTSAVPRATLNDE
DLKMHVYKKALQA
NT seq 6162 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacacatctcagctgcaggcgaccggagatccggaaaaaaaaagtcagttattt
aaaaaggacctcaaaatgaacacccaggaaaagcttatctttgcagaaaatgctctcaaa
agccagattgaaataaaggagcagttacgacttcagcaacaatcaacaatgtatgcgtcg
tcactattaagtacttctgctggtggatcagtaagagaaccgctcttaaaccagcggcat
cttaattctgtccaatacaacaagaaattcgaccgtgcccatacgcaaataccgcaaaga
caaccaacgatgagtaattcgcccgtcggattagattcaacctatttgagttatccaagc
acaaatactcatggaagtatgatatcgattaaaagtgaacagcagttgtgccagatctac
aattcgcagcaacactctgactacattatatccgattatatggataaaattgcaacaagg
attagtttactcgagacggagctaaagtttgcttggcgtgcattggacttgctgtctacg
gagtacggaaagatttggattcgtttggagaagcttgaaaacatatcaatagaacagcag
tctgtcgtcggtaatcttatggatcttatcggagcatcaaaacaagaactacatgaagtc
gacatggaaagaatggaagtacctttatatcaggaggaagatcaattgctaccgttggta
atggaggacacattggatataaatatcaaaccatctgatcatgactatgataagaatctt
acttttgaaaatcataacacctttgtaacagaacttacgcatggtactgaatctgatgag
tttatcaattctgcttgcgcaatagattccaatccaaattttgaaaacgttacattgaat
gacaaaagcttagaaattgggataattaaatttgattttgacaaaggatacgagcgaaat
cagaaaggtattcaatcggattttgaagcttcacacaagaaatcaaggattcaactttac
tcagattctgaccttatgttatatgagaggcagcagtttttagctaatagcgcccgtgcc
gaattaatgaaggaatttttaaatggacgtcgcgttttaaatgagatttcggcatcctca
ggtgcattgtccaaaatttctaaaaagggtacagatcctgtacagccaagcgaaccactt
ataagtgaccagtcgcaattcgagatagatgacaaatacgtgagacagacaagcaatgaa
cttgacagccttattggtgataagttttttcgtttagcagcctctaagacaggcgagggt
gatacacaggtactacccattgaagacactggaggaacagaaagtccagctaatatgaat
gaagtagacgaatctttctataaaaaactaaacgaggcttatcgtgacaatgaattgagc
tctgagatatttaaggtagatgcattgctacatcagtctggggccacacatgaccaaatc
gcatctatccgtaataactcagcttcttcccatgttttaaacaatcagggggtgaaggat
attacagatatacaatctttgcagactgaaaaaaccagtctcgtaacgcaggcaaaccaa
aattcgaacaaagaatcaagaaagcatagaaaaaaaaaacatcatacaaacgaaatggat
atgattaataaactaaagtgtatccttgcacaagcgcagtcaacacagattaataaagaa
gactctgaagaattggattcaaaactttcaggtccggttggtaaactaactggaacggaa
ggtacaactttgcaaaatgaatcagacaaacatagtagtaccagatatttaagagatgat
atacggaaaattttaaacaacgtaatacagactttattggaggaaataaataaaattaca
ggcttacaatcattgagtgcatcacaaattaatcagttacgaaatgctgtctggtcagaa
gaaaagttttttcaaaaaatcagccaagtcgataaaaaattaaccctgctcttacttaat
ccgttaacagtaacagaagaactgcaaaggcttagcatttcaaacacaaatgaaaagttt
gtgctggttatgaaaaagttaaaaaaaaatatagatacactaaaaaagttagttggcagc
tcattggatgattttaaaattgataattcacatgcaaatacgaccacatctcaaagcctt
aattcatcccttaattctaatgttactagttttagtgcacatttattaagaaataactcc
aatctggatgaacagttgaaaattcttgaaactcaagagattgaaatccatcggaaaaat
aaaatagaccaaattgtaagcggactttccgaagaagccgataccttaaacccaaatatt
gaatataagaactataatagttgtaccaactcaactgataatattttaagcttttcaaaa
aatatttacaatgaagatgaatacataaagtctttgaaaaagagtctagaacgccacaat
agcatgatttttttacttcatttgcaaaatcctgaaaaacacaaagtgttggctgatata
aatgatgcactaatagattcaaacagagccagtctcagtcctccaccaccagctccaacc
gatacaattaacttaaatgaggccattaatcaaatttcatatcaacaacgaaatgcaaaa
tcagactcgggactatcgtcgatgagtggttggtcacccaattcccaagtgtcggtagga
attcaaaactacgattttgtctgtaataatattttggaaaattgtagcgaaggattgcaa
tcataccattcattgcatttatctgaaaattcaaacattcacagtttaccagtcagttat
gaacgagctcaaactaataatcaaaatgagcttgtaatattagaagaaaatctaaactat
atttatgagctttctaaaaatttacctatttgttctgcctatgaaaataagtctattttc
gatatgaattgcgactcaaatgaaataagaaaattttccactgttgatgaaatgctggaa
tgggaccagctcaatgaaccggataaacaaaacttttctgtgaaacggataaactccaac
cttatgccagatctcctgactgcgcaaatacaaaattccgtatcaaagcacaataaaaac
acatattcgagcattgaatatgctggacaaaaagaaaatggaagcctgacaagacgtagc
atcatagaaccaagtatttataacggagaatcgctaaatcaatcctgcagaccttgtttg
acagatagactagtattttatccctcatcaaactctattactgatcacaatagcagccat
aatttgaattatttgggaaaacaggataaaacacggattagggaatgcggatctacacct
tcgaatcaagatccaacgaactatcttgattatactcctggtagttattctaaagggaag
ccggaggttcttactgccgcaacgaattacagtcaactggaattcaaggtcgaatcggag
tcactgttaaattctcccaatatttctagctattgtaaacaaaaaaggattgttcaggga
acatctcctgcaaagccttcaaaggtatggaacaggctaaataccatattaacacataat
ctaaagcttaagcgtgcattaaaatttaatagatcacagtctttacccggtgatatgcaa
agtcaagacgtccagagacagcctcgtggccaggccggttcgtgtccgtttatttcccac
aagcgttccaatctaggcggaagccaggttcagttatcgaaaagaattcaaaagcttcca
atgcgatttatacgacaagcgacaggagccacattcgtgcggcacttgtcaagcccggac
tccgctgtttcattagattccgctgccgatgaacgcttctcaagcgaaagaagtttacaa
aaaaaatcactttcgtccaagatgaatagtttaatgcaaaaggcaaagaagtacaaacgg
cacaacattgtcctgcgccgcggctgtaacatgtcggattctgaattagagacgacggac
tttgtttcatcggataacgataaaagtttgatatcggaaagtgaaattttattgaatcaa
tcggtcgacgtagaagacgaacgagaagaaaatttttatgataaaaatgggtgcgacttt
gactataaaagtgaattaggtggttcaattgagaagttaaatggcaacccaccaaataat
ctatttgctattgtaggtgacctaaaaaagattcaaagccccataccactggctgtctca
acagaaattcctctttttgagcatgaaaatagtaatgaatccgaaaatcacaaaaattca
cccattgaaatgccgaagattctcttagaaacgccattacagtcatgtcatcaagaatta
aactcagcacattctgacgacgaagtcgttaagaacttgctgggaaactcggtcgaaaat
aatgtaaatgcccccacccttaatatacttaatacgatcgacccaatgatgactacattt
cttacaacaacaatgacagctacaacgacaaacagcagccgtaatctcaatggcactagc
gctttatgggtcacgcagcagtgcttagaccttccaaacatttccgggtgtgggtcccga
gaagatgacgacaatcgcagtcagtattctgctcgcactctttcttcttctcgtcgacaa
agcactgaagatagcatagatacagacgacgaatacttttattatgaacttcgccagtta
gaggagcaggaaaagcaacgggcgcaaacttctgcaattgcatcttccgaaagacaagat
gacaatggagtattgttttcacaaattggacaacttctccaaaacgatgttaacggagaa
gtctgttttaacccttctgatgtctgtaaggatgaagaagacgctattatttattctcca
agtgaaagtgtaaagttacggatgtctgaagtatttaatgaactgaaaagcgtggttagt
ttagtcccaggtgtatatgatgacagtgaggtattcgcagtgtctgtcgcgactattgaa
ggaaattctattgtaaaaccaacatgtgaaaaacttgcgacagtctccgacatgcacagt
gcttggcaggatgttaatggggatttacaaattacagcatcagaaatcgattttaatgac
gaccttattgcaaataagggcagggaaactctaatttatttaaataacaaacaacgaaaa
ttgagacggttaaagaaaaaaacacgtgatcgtaaaataaatatatctaacaatgcagcc
agttccagttcctcttgccaatctgaaaatgattgtgagcagcatgaacgtaatactccc
cttggtaaatatacccaaaaatcggatgcagaaaaagctgagaatgatatatcaaataaa
tcggacgcatctagcgaaacatcaggaccagatacgccagcagagctgagcgatgttgag
ataagcgaaactgaaaacggtgtgaggactgacggccagaatatagataacatgcatgaa
aactcagcagcccttttaaaggtgaatcggaagaccctatgcaatgaccacgatttaaaa
aaccagtctttggaaacatatcagtataatacgcaaatattaaagaatattacaagtaaa
tcacttccaacgcagaaccaaattgactcaaaaaagttaaatagtcaagaatcagatgct
gatggatcccaggctataggcaatgaaatcgcggcaggtcttagcagtagcaagtggaaa
ttgctaaaaactttgaaggaacgcaagatcgaggaaaaaaataatcaagataaaattaaa
gaagatgaaatgacaaaggacagggacaagaatggaggtggtactggagaagcgggatta
cgtacgaatggtcatcccggtgacaatccattttatagcaatattgacagtatgccggac
ataaggcctcgtagaaaatccatacctcttgtgtctgaactggttctcaagacgatggcc
gctacaaaacgaaatgctggactcacatctgctgttccgcgtgctacgcttaatgacgaa
gatctgaaaatgcacgtgtacaaaaaagcgctacaagcctga

DBGET integrated database retrieval system