KEGG   Drosophila erecta: Dere_GG16792Help
Entry
Dere_GG16792      CDS       T01060                                 

Definition
(RefSeq) GG16792 gene product from transcript GG16792-RG
  KO
K04437  
filamin
Organism
der  Drosophila erecta
Brite
Cytoskeleton proteins [BR:der04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     Dere_GG16792
  Intermediate filaments
   Intermediate filament-binding proteins
    Dere_GG16792
Exosome [BR:der04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dere_GG16792
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 2429 aa AA seqDB search
MASRKTNDYHQPARQEGQQADQYEENFDEDMEAERDLAEDAQWKKIQQNTFTRWANEHLK
TIDRSINNLETDLSDGLRLIALIEVLSQKRMPKYNKRPTFRSQKLENVSVALKFLQDEGI
KIVNIDSSDIVDCKLKLILGLIWTLILHYSISMPMWDGEDDKQLNGSGHTPKQRLLNWIH
AKIPDLPINNFTNDWTTGKAVGALVDACAPGLCPDWELWDPKDAVQNASEAMGLADDWLN
VRQLIKPEELVNPNVDEQSMMTYLSQYPNSKLKTGAPLRPKTNPNRVRAYGPGIEPIGPV
VGAPANFTVETFSAGKGSVDVDIQGPNGEIEKADVRFNNDKNLTYTVSYIPKAEGSHKVA
VKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPNGVTIKKPTFFDILAKDAGRGVPE
VIIIDPANHKTSVAAKVRQLENDTWRCEYVTAMQGLHSVNVFYAGTPIPNSPFPVKVAPL
SDARKVRASGRGLQATGVRVGDDADFKIYTEGAGEGEPEVRVIGPGGMNQNVMQSKVDGN
TYECHYYPTKEGRYVIMVTFAGQEVAKSPFEVKVGPKKESSIVAYGPGLSSGVIGYPAAF
VVETNGETGALGFTVAGPSQAEIECHDNGDGSALVKYHPTAVGEYAVHILCDNEDIPKSP
FIAQILPRTDFHPEMVKASGPGLEKNGVTINQPTSFTVDPSKAGNAPLDVVVQDVFGTKL
PVELKNNPDGTKKVTYTATSGVPHTVEVNYGGVSTPNSPHRVYVGVPVDAAKVQAFGPWL
QPGVRPNAATHFNVDAREAGDAELKVKIIHEETKIEVPCRIIDNEDNTYSVEVIPPSKGA
YTTTMTYGGQRVPLGQKVVVEQTVDVSKIKVDGLEPTAPLNSLQQFRIITHGLPKADLAV
TITSPSGNRIKAHIIPTAEGFLVNFTPTQLGEYLLSICFGGTPITPRPFRLQCLTGSDSN
KVQAFGPGLERGIVGQPAEFMIDTRGAGQGGLGVTVEGPCEAAINCRDNGDGTCNVAYLP
TEAGDYTVNITFNERHITGSPFQPLIVPVPNLKNTRVSGIGIQPHGVIMNAATDFMVDMS
KVGSNIDSGKLSCAIFDPMGHVLPSKIVQGPTDDIFRIMYTPFEAGRHTIELMYDNIPVP
GSPFVVNVKSGCDPARCKAYGPGLEKGLTNQKNKFTVETKGAGNGGLSLAIEGPSEAKMT
CTDNRDGSCDVDYLATDPGEYDITIRFADKHIPGSPFRVLVEETVDPSKVKVYGPGIEHG
QVRESVPTFFNVDVGEAGPGRIAVKLTNSEGIPVDNLRVEDKGNCIYAVHYVPPKAGSVL
TCQVKFSEVEVPCSPFVMTVFPKSEPTKVKVKGVNEKKKTPASLPAEFEIDTKQAGQADI
NVAIKNPKGKAMQPRLEEVSTGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAFPTG
EAKKCKLVEQAPKIQSSGSQSHLKVDAREAGDGAVTCKITNKAGSEIVDIDVIEKDGFFD
ILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYIEEHTTKVVQQTTQSEL
VNGKSEITYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPVIQDNRDGTVSVKYDPREEG
SHELVVKYNGEPVQGSPFKFHVDSITSGYVTAYGPGLTHGVTGEPANFTISTKGASAGGL
TMAVEGPSKADINYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITGEGRK
RNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTPREIG
EHLVSVKRLGKHINNSPFKVTVCEREVGDAKKVKVSGAGLKEGQTHADNIFSVDTRNAGF
GGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVAGE
GSNRQREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEVED
GLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVVGE
AAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFNDRH
IPDSPFKVYVSPDAGDAHKLEVQQFPQGNIQADAPYQFMVRKNGAKGELDAKIVAPSGTD
DDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKDVADPAAVHASGN
GLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGYKVRYTPLLPGEHYI
TVKYNNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKSDA
SKVVSKGMGLKKAYIGKQNQFSISATDAGNNILYVGMYGPKGPCEEFHVKHAGHNNYNVQ
YLVRDRGQYVLLIKWGEEHIPGSPFQIDV
NT seq 7290 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccagaaaaacgaacgactaccaccagccagccagacaggagggccagcaggcg
gaccagtacgaggagaacttcgacgaggacatggaggccgaacgcgatctcgccgaggat
gcgcagtggaagaagatccaacagaacaccttcacccggtgggccaacgagcacctgaag
accatcgatcggtcgatcaacaacctggagacggacctgtccgacggcctccgactgatc
gccctgatcgaggtgctgtcccagaagcgaatgcccaaatacaacaaacgcccaacattc
cgcagccagaaactggaaaacgtctcggtggccctgaaattccttcaggatgagggtatc
aaaatcgttaacattgactcgtcggacatcgtggactgtaagctgaaactgatactcggt
ctgatatggacactgattctgcactactcgatatcgatgcccatgtgggatggcgaggac
gacaagcagctcaacggctcgggccacactcccaagcagcgcctgctgaactggatacac
gccaagatacccgacttgcccatcaacaacttcaccaacgactggaccacgggcaaggcg
gtgggcgcccttgtcgacgcctgtgctccgggtctctgtcccgactgggagctgtgggat
cccaaggatgccgtgcagaacgcctccgaggccatgggcctggccgatgactggctcaac
gtgcgccagctgatcaagcccgaggagctggtcaaccccaacgtggacgagcagtctatg
atgacctatctgtctcagtacccgaactccaagctcaagactggagctcccttgaggccc
aagacgaatcccaacagagtgcgtgcctatggtcctggtattgagcctattggtcctgtg
gtgggagccccggccaatttcaccgtcgaaaccttctctgctggcaaaggttccgtggat
gtggacatccagggacccaatggcgagatcgagaaggctgatgtgcgctttaacaatgac
aagaacctcacgtacacagtttcctacatacccaaagccgagggttcgcacaaggtggcg
gttaagttctccggtcgcgacatccccaagtcgccgttccccgtgaaggtggaaggtcat
gctggagacgcctctaaggtgaaggttacggggcccggaatacagcccaacggtgtcacc
atcaagaagccaaccttcttcgacatcctggccaaggatgcgggtcgcggagtgcccgaa
gtgattatcatcgatccggcaaaccacaagacctctgtggccgccaaagtgcgtcaactg
gaaaacgatacttggcgctgcgagtatgtgaccgctatgcaaggactgcattcggtgaat
gtcttctatgctggaactccgatccccaacagtccgtttccggtgaaagtagctccactg
tctgatgcgcgtaaagttcgtgcttccggtcgtggtctccaggcaacgggcgttcgcgtc
ggtgacgatgccgacttcaagatctatactgagggagccggcgagggtgagccagaggtg
cgcgtcattggtcctggaggcatgaaccagaacgtcatgcagtcgaaggtggatggcaat
acctacgagtgccactactatcccaccaaggaaggccgctacgtcatcatggtgaccttt
gctggccaagaagttgccaaatcaccgtttgaggtgaaggtgggtcccaagaaggagtcc
tcgattgtggcctacgggcccggactgagcagcggcgttatcggctacccggctgccttt
gtagttgagaccaatggcgagaccggcgccctcgggttcaccgtggccggtccctcgcag
gccgagatcgagtgccacgacaacggcgatggctctgccctggtcaagtaccatcccacc
gctgtgggagagtacgccgtgcatattctgtgcgacaatgaggacattcccaagtcgccg
tttatcgctcagatccttccgcgcaccgatttccatcccgagatggtcaaggctagtggt
cctggactggagaagaatggcgtgaccatcaaccagccgaccagctttactgtggacccc
agcaaggcgggcaatgctccgttggatgttgtcgttcaggatgtgttcggcaccaagttg
cccgtggagctaaagaacaaccccgatggcaccaagaaggtcacgtatacggctacttct
ggagttccgcacaccgtcgaagttaactatggcggagtttctacgcccaattcaccccat
cgtgtgtacgtcggagttccggttgatgcagccaaggtacaggcctttggaccctggctg
caacctggagtgcgccccaatgcggccacacacttcaatgtggacgcccgtgaggctgga
gatgccgagctgaaggtgaagatcatccatgaggaaaccaagatcgaggtaccgtgccgc
atcatcgataacgaggacaacacctactcggtggaagtgattccgccttccaagggcgcc
tacaccactacaatgacgtatggtggccaaagagttcccctgggacagaaggtcgtcgtg
gaacaaacggtggatgtatccaaaatcaaggtggacgggcttgagccaaccgcgcccttg
aacagtttgcagcagtttcggattattacgcatggcctgcccaaagcggacttggcggtg
accatcaccagtccatcgggcaatcgcataaaggcccacatcataccgaccgcagaggga
tttctggttaactttacgccaacacaactgggcgagtacttgttaagcatctgctttggg
ggcacgccgatcactccacgtcccttccggctgcagtgcctcacaggcagcgattcgaac
aaggtgcaagcctttgggcctggcctggaacgaggcattgtgggccagccggcagagttt
atgatagatacgcgtggcgccggacagggcggattgggagtgacggtggaaggaccctgc
gaggcggccatcaattgccgcgataatggagatggcacttgcaacgtcgcctatttaccg
actgaggccggcgattataccgtcaacataacgttcaacgagcggcacataaccggctcg
cccttccagccactaatagttccggtgccgaatctgaagaatacccgcgtcagcggcatc
ggcatccagccgcatggtgtgatcatgaatgcggccacggacttcatggttgatatgagc
aaggtgggcagcaatattgactccggaaagctgtcctgtgcgatcttcgacccaatgggc
catgtgttgccgagcaagattgtgcaaggtccaaccgacgacatcttccgcatcatgtac
actcccttcgaggctggccgccacaccattgagctgatgtacgacaacatcccggtgcca
ggatctccgtttgttgtgaacgtgaagagcggctgcgatcccgctcgctgcaaggcctac
ggaccaggcctggaaaaaggactgaccaaccagaaaaacaaattcaccgtggagaccaag
ggtgcaggaaatggtggcctttcgctcgccatcgagggcccttcggaggcaaaaatgacg
tgcacggacaatcgcgatggtagctgcgatgtggactatttggccactgatccaggagag
tatgacattaccattcggtttgccgacaagcacatacccggctctccattccgcgtgctc
gtcgaggagacggtggaccccagcaaggtgaaggtgtacggtccgggcatcgagcacggc
caggtgcgcgagagcgtgcccaccttcttcaacgtggatgtgggcgaggctggtcctggc
cgcattgccgttaagctgaccaactccgagggtattcccgtggacaatctgcgcgtggaa
gacaagggcaattgcatttacgcggttcactatgtgccgcccaaggctggctccgtgctc
acctgccaggtgaagttctcagaggttgaagtgccatgcagtccatttgtgatgaccgtt
ttccccaaatcagaacccaccaaggtaaaggtaaagggtgtcaatgagaagaagaaaacg
cctgcttcccttcccgccgagtttgaaatcgatacaaaacaggctggccaggctgatatc
aatgtggccattaagaaccccaagggcaaggcgatgcaaccgcgcctggaggaggtgtcc
accggtacgtacgtggtgtccttcgtgccagatgagtgcggcacctaccagtgcagcatc
aagtacggcgacaaggagatcgagggctcgcccttcaaactcgaagcattccctaccggc
gaggccaagaagtgcaagctggtggagcaggcgcccaagattcagtcctcgggcagtcaa
tcgcacctgaaagtggatgcccgtgaggccggagatggagcggtgacctgcaagatcacc
aacaaggcgggcagcgaaattgtcgacattgatgtgatcgaaaaggatggtttcttcgac
attctgtacgcccttaacgatcctggagattatgacatcaacgtaaagtttggtggcaag
gacatcccgaacggcagcttctccatcaaggctgtcgaaagtatcgagcaatactcgcat
agtgaatatatcgaggagcacacgaccaaagtggtgcagcaaactacgcagagcgagctt
gtcaacggaaaatctgagatcacgtatcgcagtgtagcattcgagaagttaccactaccc
acaacaggcggcaacgttacagctgaagtcagaatgccgagcggtaaagtagacaaaccc
gtgatccaggataaccgtgatggtaccgtctcggtgaagtacgatccccgtgaggaggga
tcccacgagctcgtggtcaaatacaacggagaacccgtgcagggatctcccttcaaattc
cacgttgactcgatcacctccggctatgtgactgcctatggacccggcctgacccatgga
gtcaccggtgagccggccaactttaccatctccaccaagggagccagcgccggcggcctg
accatggccgtcgaaggacccagcaaggctgacatcaactaccatgacaacaaagacggc
actgtgtccgtgcaatacctgcccactgctcctggcgagtaccaggtgtccgttcgcttc
ggcgataagcacatcaagggttcgccgtacttcgccaagatcaccggcgagggtcgcaag
cgtaaccagatctcggtgggctcctgctccgaagtgaccatgcccggcgacattaccgat
gacgatctgcgcgccttgaacgcctcgatccaggcgcccagtggcctggaggagccctgc
ttcctgaagcgcatgcccactggcaacattggcatctcgttcacgccccgcgagatcggc
gagcacctggtttcggtgaagcgtctgggcaagcacatcaacaactcaccctttaaggtg
actgtctgcgaacgcgaggtgggcgacgccaagaaggtcaaggtttccggagctggccta
aaggagggtcaaacccacgctgacaacatcttctccgtggacacgaggaacgccggcttc
ggtggactttcggtctccattgagggtcccagcaaggctgagatccagtgcacagataag
gatgacggtaccctcaacatctcgtacaagcccacggagccgggctactacattgttaac
ctgaagttcgccgatcaccacgtggagggttcacctttcaccgtgaaggttgccggtgag
ggaagcaaccgccagcgcgagaagatccagcgggagcgcgatgctgttccaatcacggaa
attggcagccagtgcaagttgacattcaagatgcccggcattacctcattcgatctggcc
gcctgcgtcacctctcccagcaacgtgaccgaggatgcggagatccaggaggtggaggat
ggcctctacgcagtgcactttgtgcccaaggagttgggcgtgcacacggtatcggtgcgc
tactccgagatgcacatacccggatcaccgttccagttcaccgtgggaccgctgcgcgac
tccggcagccatcttgttaaggctggaggttctggcctggagcgaggcgttgtcggagag
gcggccgagttcaatgtgtggacccgcgaagcaggcggtggttccctggccatttccgtg
gagggtcctagcaaggctgatatcgagtttaaggaccgcaaggacggcagctgcgatgtg
tcctacaaggtcaccgaaccgggagagtaccgcgtgggcctgaaattcaacgatcgccac
atacccgactcacccttcaaggtatacgtctcccccgatgcgggcgatgcccacaagctg
gaggttcagcagttcccgcagggcaacatccaggcggacgctccctaccagttcatggtg
cgtaagaacggcgccaagggtgagctggatgccaagattgtggctccatccggaacggac
gatgattgcttcatccaggtgatcgacggtgagatgtactcggtgcgcttctatccacgc
gagaacggaatccatgccatccacgtcaagttcaacggcgtccacatacccgactctcca
ttcaggatcaaggttggcaaggatgtggccgatccagctgctgtgcacgccagcggcaat
ggcttggacgaagtgaagactggacacaaggccgacttcatcatcaatacctgcaacgcc
ggcgttggcactttggccgtctccatcgatggaccctccaaggtggccatggactgcacg
gaggtggaagagggctacaaggtccgctacacccctctgctgcccggcgagcactacatc
acggtcaagtacaacaacatgcacatcgtgggatcgccattcaaggtcaacgctaccggc
gacaagctggcggatgagggcgcccaggagacgtccacggtgatcgtggagacagtgcag
aaggtggccaagggtggcaagaacacgggcgtccatctgcccaccttcaagtctgacgcc
agcaaagtggtgtccaagggtatgggcctgaagaaggcctacattggcaagcagaaccag
ttcagcatcagcgccaccgatgcgggcaacaacatcctgtacgtgggcatgtacggacca
aagggaccctgcgaggagttccacgtgaagcacgctggccacaacaactataatgtgcag
tacctggtgcgcgaccgcggccagtacgtgctcctaatcaagtggggcgaggagcatata
cccggctccccattccagatcgatgtgtag

DBGET integrated database retrieval system