KEGG   Drosophila erecta: Dere_GG16809Help
Entry
Dere_GG16809      CDS       T01060                                 

Definition
GG16809 gene product from transcript GG16809-RA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
der  Drosophila erecta
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:der00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 546 aa AA seqDB search
MRLQLLFFIGLSALVSDGESSHDAERRMHPVFSLMGTGSNPVGGGRFKRAMPQIVFNALR
TEERYAEYWQGMAAQTLDQQLDSKLRLNTQLARNVMLFIGDGMSIPTITAGRVYLGGEEQ
QFAFEQFPYVGLSKTYCANMQVADSACTATAYLGGVKANYGTIGVTAAVQFKDCQAQAQA
AHHVSSIAAWAQKQGMATGLVTTTSVTHASPAGVYAHLANRNWENDAEVVADNGDPELCP
DAAAQLINSPVGQKLNVIMGGGRENFLPKGVTDASGAPGRRLDGRNLIEEWKRQHTNSAH
YVQNRRELLKLTNHTSRVLGLFAPYHMAYHLDASPAEQPTLEEMVQSAMEILERQSAGRG
YFLFVEGGRIDHGHHDTLALRAIDETAEFDKAVKFARSHTSTDDTLIVVSSDHSHTMSLA
GYSSRKNDIFGINDGQLAADDLPYATLSYANGPGYDSNYLREGGAVRRKNLRAINMKNKD
FMFPSTVPLASETHGGDDVAVFASGPYAQLFTGVFEQNFIPHALGYASCLTDRNMCVDGG
VARRPR
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgcagctcttgtttttcatcggcctgagtgctctagtcagtgatggagaatcc
tcacacgatgccgagaggcgcatgcatccggtgttctcgctaatgggcacaggatcgaat
ccagttggaggaggtcggttcaagcgagccatgccccagatcgttttcaatgccctgagg
acggaggagcgctatgccgagtactggcagggcatggcggcccaaacgctggaccagcag
ctggatagcaagctgcgcttgaacacccagctggccaggaatgtgatgctcttcatcggc
gatggcatgtccataccaacgatcacggcgggtcgcgtttacctgggcggcgaggagcag
cagttcgccttcgagcaattcccgtatgtgggtctcagcaagacctactgtgccaatatg
caggtggccgactccgcctgcaccgccaccgcctatttgggtggtgtcaaggccaactat
ggcaccatcggtgtgacagcagcggtgcagttcaaggattgccaggcgcaggcacaagcc
gcccaccatgtgtcctccattgcggcctgggcgcagaagcagggaatggccacgggactg
gtcaccacaacctccgtaacacatgcctcgccagctggagtgtacgcccacctggccaac
cggaactgggagaacgacgccgaagtggtggcagacaatggtgaccccgaactgtgtccg
gacgccgctgcccagctgataaacagtcctgtgggtcagaaactcaatgtgataatgggc
ggaggtcgcgagaatttcctgcccaaaggcgtgacggatgccagtggagcacctggtcgt
cgcttggatggacgtaatctcatcgaggagtggaagaggcagcacacgaacagtgctcat
tatgtgcagaaccgcagggagctgctcaagctaacgaatcacacttcacgagtactgggc
ttgtttgccccctaccacatggcctaccacctggatgcgagtcccgcggagcaaccaacc
ttggaggagatggtccagtcggccatggaaatcctggagcgtcagagtgccggacggggc
tacttcctcttcgtcgagggcggccggatcgatcatggccaccacgacaccttggctttg
agggccatcgatgagacggcggagttcgataaggcggttaaatttgccaggagtcacacg
agtacggatgacaccttaattgtggtcagttcggaccactcgcacaccatgtcgctggcg
ggctattccagcaggaagaacgatatcttcggcatcaatgacggacagctggcggcggat
gatctaccatatgctaccctgagctatgccaatggaccgggctatgatagtaactacctc
agggaaggaggcgctgtgaggaggaaaaatctgagagccatcaacatgaagaacaaggac
tttatgttccccagcacagttcccttggcatcggaaacgcatggcggcgatgatgtggcc
gtctttgccagtggaccttatgcccagcttttcaccggagtattcgagcagaacttcata
ccccacgccctcggttacgcctcttgcctcactgaccgtaacatgtgcgtggatgggggc
gtggcacggagaccacgttga

DBGET integrated database retrieval system