KEGG   Drosophila erecta: Dere_GG17010Help
Entry
Dere_GG17010      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
der  Drosophila erecta
Pathway
der00670  One carbon pool by folate
der00790  Folate biosynthesis
der01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dere_GG17010
   00670 One carbon pool by folate
    Dere_GG17010
Enzymes [BR:der01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Dere_GG17010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-GeneID: 6553240
NCBI-ProteinID: XP_001980195
FlyBase: FBgn0109238
UniProt: B3P134
Position
Unknown
AA seq 183 aa AA seqDB search
MIRFNLIVAVGENFGIGYKGDLPWRIKSELKYFSRITKRTNDPSKHNAVVMGRKTYFGVP
ESKRPLSNRLNVVLSTTLQENELPEGVLLCSNLETALKVLENKNDVENVWIVGGSGVYKE
AMASPRCHRLYITKILHKFECDTFFPAIPDSFREVAPDSDIPLGVQEENGIHFEYKVLEK
QSK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgatacgcttcaatttaatcgtagcagttggcgagaatttcggaatcggctacaaaggc
gatctaccgtggcgcatcaaatccgagcttaagtactttagccgcattaccaagcgaaca
aacgatcccagcaagcacaatgccgttgtgatgggcagaaaaacctacttcggagtgccg
gaaagcaagagacctctttccaatcggctgaacgtagtgctgagcaccacacttcaggaa
aacgaattgcccgagggagtactgctgtgttccaatctcgagacggccttgaaagtcctc
gagaacaagaacgatgtggagaacgtttggattgtgggcggtagtggggtctacaaagaa
gccatggcctcgccaagatgtcaccggctgtacatcactaaaatcctgcacaagttcgaa
tgcgacacctttttccccgcgatcccagacagcttccgcgaggtcgcgcccgattcggac
ataccactcggtgttcaggaggagaatggcatccatttcgagtacaaggtcttggagaaa
cagtcaaaataa

DBGET integrated database retrieval system