KEGG   Drosophila erecta: Dere_GG17127Help
Entry
Dere_GG17127      CDS       T01060                                 

Definition
GG17127 gene product from transcript GG17127-RA
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
der  Drosophila erecta
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:der03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 302 aa AA seqDB search
MGDVMNIDSIISRLLEVRGARPGKNVQLSEGEIRGLCLKSREIFLSQPILLELEAPLKIC
GDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYCENFFLLR
GNHECASINRIYGFYDECKRRYSIKLWKTFTDCFNCLPVAAIVDEKIFCCHGGLSPDLTS
MEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLQKHEFD
LICRAHQVVEDGYEFFAKRMLVTLFSAPNYCGEFDNAGAMMSVDDTLMCSFQILKPADKR
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacgtgatgaatatcgacagcataatatcgcgacttctggaagtgcgtggggca
cggccaggcaaaaacgtacagctctcggagggtgaaatccggggactctgcttgaagtcg
cgcgagatcttcctatcgcagcccattctactcgagctggaggcgccgctgaagatctgc
ggcgacatccatggacagtactatgatctgttgcgtctgttcgagtacggcggttttccg
ccggagtcgaattacctgttcctgggcgactacgtcgatcgcggcaagcagtcgctggag
accatctgcctgctgctcgcttacaagatcaaatactgtgagaacttcttcctgctgcgc
ggcaaccacgagtgcgccagcatcaatcgcatatacggattctacgacgagtgcaagcgt
cgctacagcatcaagttgtggaagacattcacggactgcttcaactgcctgccggtggcg
gccattgtcgatgagaagatcttctgctgccacggcggcctcagtcccgatttgacatct
atggagcagatccgtcgcattatgcggcccaccgatgtgcccgaccagggcctgctgtgc
gatctcctgtggtccgatcccgataaggataccatgggttggggcgaaaacgaccgcggc
gttagcttcaccttcggcgccgaggtggtagccaagtttttgcagaagcacgagttcgat
ctcatctgccgagcccatcaagtcgtcgaggatgggtatgagttctttgccaaacgcatg
ctggtcaccctgttctcggcgcccaactactgtggcgagttcgacaatgccggcgccatg
atgtccgtggacgacacgctgatgtgctcgttccagatcctcaagccagctgacaagcgt
aaaaagtaa

DBGET integrated database retrieval system