KEGG   Drosophila erecta: Dere_GG17203Help
Entry
Dere_GG17203      CDS       T01060                                 

Definition
GG17203 gene product from transcript GG17203-RA
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dere_GG17203
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     Dere_GG17203
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     Dere_GG17203
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 605 aa AA seqDB search
MAAAKCGCLKKEARVHVIYVGGTIGMIRNESGVLHTVPKVLGEQLQEFPSCHDRNYNSKD
DDCGMMVLPAVSGAPYRVLYDLVEFCPLLDSSCMGFCDWKRIANEVGKTYNSYDGFVILH
GTDTLAYSASALAFMLESLNKPVILTGAQIPIFEARSDGRENFLGALLIAGNYNIPEVLV
FFGNKILRGCRSTKLNSDSFHALDSPNLAPLGRASVNIEINSRQIFRPCNIKPFSLHSEL
EKNVALLRIYPGISVTVVQAILKEPTKGVVLQTFGAGNFPVNREDLLDELREAVHRGVII
VNTTQCSAGMVANIYETGQGLLDVGVIPGYDMTQEAAFTKLAYVLSKPEWDIANKKKVML
LSLRGELTTNKVAKINDIDLIEGVARTLHMSTAMERKQMCSTFYPALVAAAVTEGDVHKL
GDLKQYGANLCDTNCDGRSAMHLACFLGKLNCVCFLMSAGCPVNVHDRFNRTPLHEAIDT
DNHDIIRALLKNGAKLNDQPLVQAELLRALTERGKIKRLESFRLAGANLTLADRTGRTAL
HYACQLGNHEVVEYLLPHYENPYIKDELGMSPIDYAKAANHAHILTLMRFKEKELAKQDP
CSCTY
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggcaaagtgcggttgcttgaagaaggaggctcgcgtccatgtcatctacgtg
ggtggaaccatcggaatgatccgcaacgagtccggagtactgcacaccgtgcccaaggtg
ctgggtgagcagcttcaagagtttcccagctgccacgacaggaattacaacagcaaggat
gatgactgtggcatgatggtgctacccgctgtgtctggtgctccgtatagagtcctttac
gatttggttgagttctgcccactgttggactccagctgcatgggcttctgcgactggaag
cgcattgccaacgaagtgggaaaaacatacaattcctatgacggcttcgtaatcctccat
ggaactgataccttagcgtactccgcctcggcactagcattcatgctggagagcctgaac
aaacccgttatacttactggggcacagattccgatctttgaggcgcgcagcgatggtcgg
gagaacttcttgggcgcacttctgatagcaggcaattacaatatacccgaggtgctggtc
ttctttggcaacaagattctgcgtggctgtcgctccacgaagctcaattcggactccttt
catgcactggactcacccaatttggcaccattgggtcgggcgagtgtcaacatcgagata
aacagccgccaaatcttccgtccatgcaatattaagccattttcgcttcattcggaactc
gaaaagaacgtggctctgctgcggatttatccgggaataagtgtcactgtggtacaggca
atactgaaggagccaacgaaaggtgtggtcctccagacctttggagccggtaactttccg
gtgaatcgtgaggacttgctggacgaattgagggaggcggtccacagaggcgttattatc
gtcaacaccacccagtgctcggcgggcatggtggccaacatttatgagacaggccagggt
ctgctcgacgtgggcgtaattcccggctacgatatgactcaggaggccgcctttaccaag
ctggcctatgtgctgtccaagccggagtgggacattgccaacaagaagaaggtgatgctg
ctgagtctgcgcggcgagctgaccaccaataaggtggccaagatcaacgacattgatctg
atcgagggcgtggcccgcacattgcacatgtccacggcgatggaacggaagcagatgtgc
tccacattctatcccgccttggtggcggccgcagtcaccgaaggtgatgtccacaagttg
ggcgatcttaagcagtacggcgccaatctgtgcgacaccaactgcgatggacgctccgcc
atgcacttggcctgcttcctgggcaaactgaattgcgtctgcttcctgatgtcggccggt
tgtcctgtaaatgtccacgatcgattcaaccgcacgccattgcacgaggccatagacacg
gacaaccatgacataatcagagcgctgctcaagaacggggccaagctcaacgatcagccg
ctggtccaggcggagctactgcgtgcccttaccgagcggggtaagatcaagcgtttggag
tcatttcggctggccggtgccaatctcacgctggccgatcggacaggacgaacggctctg
cactacgcctgccaattgggcaaccacgaggtggtcgaatatctgctgccgcactacgag
aatccctacatcaaggatgagctgggcatgtcgcccatcgactacgccaaggcagccaat
catgcccatatcctgaccctgatgcgattcaaggagaaggagctcgccaagcaagatccg
tgttcctgtacgtattag

DBGET integrated database retrieval system