KEGG   Drosophila erecta: Dere_GG17592Help
Entry
Dere_GG17592      CDS       T01060                                 

Definition
GG17592 gene product from transcript GG17592-RA
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
der  Drosophila erecta
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dere_GG17592
Enzymes [BR:der01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dere_GG17592
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1465 aa AA seqDB search
MDVLEMLRASASGSYNTIFSEAWCQYVSKQITATMYMYCALGMMGVLFLAWFMYFKRMAR
LRLRDEIARSISAVTNSSGDLRGLRFRKRDKMLFYGRRMLRKMKNVSGQMYSSGKGYKRR
AVMRFARRILQLRRDNMPLEMRTVEPPAEYLEETIEGSDRVPPDALYMLQSIRIFGHFEK
PVFLRLCKHTQLLELMAGDYLFKITDPDDSVYIVQSGMINVYISNADGSTLSLKTVRKGE
SVTSLLSFIDVLSGNPSYYKTVTAKAIEKSVVIRLPMQAFEEVFQDNPDVMIRVIQVIMI
RLQRVLFTALRNYLGLNAELVQNHMRYKSVSTMSGPINSQTSQSSRQTPNGPPMGISHPL
NLMQSTASGTGSGSGSGVSVTVTRPPPSPSRHSREEHTLSDPNPNPDGSVHGTSNLFTEV
HGDAPNADLFHQQQQSVGNLSTRRSSITQMTPDGSHSCPPAPGVTTSIDMRLVQSSAVES
LRKELGLSEEDAHIIEPFVELRELEPNVTLITEGNADDVCVWFVMTGTLAVYQSNQDATR
AKQDKSDMLIHFVHPGEIVGGLAMLTGEASAYTIRSRSNSRIAFIRRAAIYQIMRQRPRI
VLDLGNGVVRRLSPLVRQCDYALDWIFLESGRAVYRQDESSDSTYIVLSGRMRSVITHPG
GKKEIVGEYGKGDLVGIVEMITETSRTTTVMAVRDSELAKLPEGLFNAIKLRYPIVVTKL
ISFLSHRFLGSMQTRSGSGAPGAPVEANPVTHKYSTVALVPITDEVPLTPFTYELYHSLC
AIGPVLRLTSDVVRKQLGPNIFEAANEYRLTSWLAQQEDRNIITLYQCDSSLSAWTQRCM
RQADVILIVGLGDRSHLVGKFEREIDRLAMRTQKELVLLYPEATNAKPANTLSWLNARPW
VTKHHHVLCVKRIFTRKSQYRINDLYSRVLLSEPNMHSDFSRLARWLTGNSIGLVLGGGG
ARGAAHIGMLKAIQEAGIPVDMVGGVSIGALMGALWCSERNITTVTQKAREWSKKMTKWF
LQLLDLTYPITSMFSGREFNKTIHDTFGDVSIEDLWIPYFTLTTDITASCHRIHTNGSLW
RYVRSSMSLSGYMPPLCDPKDGHLLLDGGYVNNLPGHLWRYCRASMSIAGVFPPFCDYRD
GHLLLDGCYTNNVPADVMHNLGAAHIIAIDVGSQDDTDLTNYGDDLSGWWLLYKKWNPFT
SPVKVPDLPDIQSRLAYVSCVRQLEEVKNSDYCEYIRPPIDKYKTLAFGSFDEIRDVGYV
FGKNYFENMAKAGRLGRFNQWFNKEPPKRVNHASLNEYTFIDLAQIVCRLPETYAVNTAD
LFSEDEDCDGYISEPTTLNTDRRRIQVPRAGNSLSFSETEMDSDVELDLKLERKTDKSTQ
SSPPTSSRTSMRGKEEARHMDNWHWGAKHKNETGSGATEGIHTSTEQEQEHQQQQQQDQG
VRAEQLVYKDEDKENRSSANNETKN
NT seq 4398 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcctggaaatgctgcgcgccagcgccagcggtagctacaacacgatcttctcg
gaagcgtggtgtcaatatgtttccaagcagatcacagcaacgatgtacatgtactgcgct
ttgggcatgatgggcgtgctcttcctcgcctggttcatgtacttcaagcgaatggcgcgt
ttgcggctgcgcgacgagattgcccgttccattagcgccgtaacaaactcatccggcgat
ctgcgtggcctgcgtttccggaaacgggacaagatgctcttctatggccgacggatgttg
cgcaaaatgaagaacgttagcggtcagatgtatagcagcggaaagggctacaagcggcgg
gctgtgatgagattcgcgcgaaggatactccagttgcggcgggacaatatgccgctggag
atgcgcaccgtggagccgccagccgagtatctggaggagacaatcgagggcagcgataga
gtaccgcccgatgcgctctatatgctccagagcattcgcatctttggccacttcgagaag
cccgtctttctgcggctctgcaagcacacccaattgctggagctgatggccggcgactat
ctgttcaagattaccgatccggacgatagcgtctatatcgtccagtcgggcatgattaat
gtgtatatctccaatgccgatggcagtacgctgtcattgaagacggtcaggaagggcgag
tcggtgacgtcgctgctcagctttatagatgtcctgtcggggaatcccagctactacaaa
acggtcacggccaaggccattgagaagtcggtggtcattcggctgcccatgcaggccttc
gaggaggtgttccaggacaatccggacgtgatgattcgcgtcatccaggtgattatgatc
cggctgcaacgcgtcctgttcaccgctctgcgcaactatctcggcctgaatgccgagctg
gtgcagaatcacatgcgctacaagagcgtatccacaatgagtggaccgatcaactcgcaa
acctcgcagtcctcacgccagacgcccaatggcccgcccatggggatcagccatccgctg
aatctgatgcagtccactgcttcgggaacgggttcgggatcgggatcgggtgtctcggtg
accgtaacccggccaccgccgtcgccatcgcgtcactcgcgcgaggagcacacgctatcc
gatccgaatcccaatccggatggcagtgtccatgggacaagcaatctgtttaccgaggtg
catggcgacgctccgaatgcagatctattccaccagcagcagcagtccgtgggcaaccta
tccacgcgtcgcagttccataactcagatgacgcccgatggctcgcactcctgtcctccg
gcgcccggggtgacaacctcgatagacatgcgcctggtgcaatcctctgcggtggagagt
ctacgcaaagagttgggtttgtccgaggaggatgcccacatcattgagccatttgtggag
ctacgggaactggagccgaatgtcaccctgattacggagggcaatgcggacgatgtttgc
gtttggtttgtgatgacgggcacgttggctgtttaccagagcaatcaggatgccacgcgg
gccaagcaggataagagcgacatgctcatccactttgtccatcctggcgaaatcgttggc
ggactggccatgctcacgggagaggccagtgcgtataccattcgatcgaggagcaacagc
aggatagccttcattcggcgcgcagccatataccagatcatgcgacaacgaccgcgcatt
gttttggatctgggcaacggagtagtacgccggctatcgccgctggtgaggcagtgtgac
tacgccttggactggatctttctggagtcgggcagagctgtctatcggcaggacgagagc
agcgacagcacatacattgtactcagcggtcgtatgcggtcggtgatcacgcatcctggt
ggcaaaaaggagatcgtcggcgaatacggcaagggggatcttgtgggcatcgtcgaaatg
atcacggaaacgtcgcgcaccacgacggtgatggctgtgcgcgactcggagctggccaag
ctgcccgagggcctgttcaatgccatcaagctgcgctaccccatcgtggtgaccaagctg
attagcttccttagccaccgcttcctcggctcgatgcagacgcgctcgggcagcggggcg
ccgggcgcgcccgtcgaggccaatcccgtcacgcacaagtactccacggtggccctggtg
cccatcaccgacgaggtgccgctgacgcccttcacctacgagctctaccactcgctctgt
gccataggacccgttctccgtttgacctcggatgtggtgcgcaagcagctgggtccaaac
atcttcgaggcagccaacgagtaccgcctaacctcgtggctggcgcagcaggaggaccgc
aacatcatcaccctctatcagtgcgacagttcgctgagcgcttggacgcagcgctgcatg
cggcaggcggacgttatcctgatcgtgggcctcggcgatcgctctcatctggtcggaaaa
ttcgagcgcgagatcgatcggctggcgatgcgaacgcagaaggagctcgtcctgctgtat
ccggaggccaccaatgccaagccggccaacacgctcagttggctcaatgcccgaccctgg
gtgaccaagcaccatcatgtgctctgcgtcaagcggatcttcacgcgcaaaagtcaatac
cgcattaatgatctctacagtcgcgtcctgctgtccgagccaaacatgcattccgacttc
tcgcgtttggcccgctggctgacgggcaactccattggcctggtgctgggcggcggagga
gctcgtggagctgcccacattggtatgctgaaggccatccaggaggcgggcataccggtt
gacatggtgggcggcgtcagcattggtgccctgatgggtgctctatggtgctcggagcgt
aatatcaccacggttacgcagaaggcacgcgagtggtcaaagaaaatgacgaaatggttc
ctacaactacttgacctcacctacccgatcacatcgatgttctccggacgggagttcaat
aagaccatccacgacacattcggggacgtgagcatcgaggacctgtggataccctacttc
accctcaccaccgacatcaccgccagctgccatcgcattcacaccaatggatctctgtgg
cgttacgtacgctcctccatgtcgctcagtggctacatgccaccgttatgcgatcctaaa
gatgggcatctcttactggatggcggctatgtgaataatctgccaggccacctgtggcgg
tactgccgcgccagcatgtcgattgccggcgtcttcccaccattttgtgattaccgtgat
ggccacctgctgctcgatggctgctacacgaacaacgtgccagccgatgtgatgcacaat
ctgggcgctgctcacataatcgccatcgatgtgggatcccaggatgacacggacctcacc
aactacggcgacgacctgagcggttggtggctgctctacaagaaatggaatcccttcacg
tcgccagtgaaggtgcctgacctacccgacatccaatctcgactagcctatgtgtcctgt
gtgcgccaactagaggaggtcaagaactccgactactgcgagtatatccgaccgccgatc
gataagtacaagactctagccttcggcagcttcgacgagattcgcgacgtgggctatgtc
tttggcaaaaactacttcgagaacatggccaaggcgggtcggttgggccgcttcaatcag
tggttcaacaaggagccgcccaagcgggttaaccacgcctcactcaacgagtacacgttc
atcgatctggcgcagatcgtttgtcgtctgccggagacatacgcggtgaatacggcggat
ctctttagcgaggacgaagactgtgatggctacatctcggagccgaccacgcttaatacg
gatcggcgacgcattcaggtgccgcgcgctggcaactcgttatccttctccgagaccgaa
atggactcggacgtggagcttgacctgaagctggagcgcaaaacggacaagtccacgcag
tcatcgccgccgacgagcagcaggacgagcatgcgtggcaaggaagaggctagacatatg
gataattggcattggggtgcgaagcacaagaatgagactggcagcggagccactgaaggc
atacacacatcgaccgagcaggagcaggaacaccagcagcagcagcagcaggatcagggt
gttagggcagagcagctggtgtacaaggatgaggacaaggagaacagaagtagcgcgaat
aacgaaaccaaaaactag

  All links  
No link information was found.   
DBGET integrated database retrieval system