KEGG   Drosophila erecta: Dere_GG17656Help
Entry
Dere_GG17656      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K01691  WNT inhibitory factor 1
Organism
der  Drosophila erecta
Pathway
der04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:der00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dere_GG17656
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WIF EGF_2 EGF hEGF
Motif
Other DBs
NCBI-GeneID: 6551538
NCBI-ProteinID: XP_001978481
FlyBase: FBgn0109878
UniProt: B3NXV7
Position
Unknown
AA seq 449 aa AA seqDB search
MALVDSAGETMTHQGTGCLVKWLYLVLIVHTLLCLGQIECRQNQNRNNNNNNKRADSSSS
EEGHVNSSDLLDNFADQDASFVSHGHQPRRGQRKKGGGGGSRHNRNEESGISLWINEQQL
KMLTALYFPQGYSERLYAIHNSRVTNDLRDTTLYNFLVIPSEVNYVNFTWKSGRRKYFYD
FDRLQTMDESILKAPTLSIRKSGRIPQEQKNFSIFLPCTGNSSGTASFNVGLKIQTRNNK
PLSGTPIRLNFKKECAHRGVYDIDASNPTSLTTLQECSLKCGKNGYCNDHHICKCNVGYT
GQYCETAFCFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDKCLNGGKCIQKDKCQCS
KGYYGLHCEYSKCVIPCKNDGRCIGNNLCRCPNGLRGDHCEIGRKQRSICKCRNGTCVSH
KHCKCHPGFYGRHCNGRKRHIHRNNDSKF
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggccctcgttgactcggctggggaaactatgacacatcagggcaccggctgcctggtc
aagtggttatatctggtgctgatcgtgcacacgctcctctgcctcggccagatcgagtgt
cgccagaaccagaatcggaataacaataacaataacaaaagagcggactcgtccagctca
gaggaaggccacgtcaactccagcgatctcctggacaactttgcggaccaggacgccagc
ttcgttagccatggccaccagccacgtcggggccaacgaaagaaaggaggaggcggtggc
agccggcacaatcgcaacgaggagagcggcatctcgttgtggatcaatgagcagcagctc
aaaatgcttacagcgctctacttcccacagggctactcggaacgcctgtacgctattcac
aatagccgggtgaccaacgacctgagggacaccacgctgtacaacttcctggtaatcccc
tcggaggtgaactacgttaacttcacatggaagtcggggcgccgcaagtacttctatgac
tttgatcgcctgcagaccatggacgaaagcattctaaaggcaccgacgctgtccattcgc
aagagcggacgcattccgcaggagcagaagaattttagcatattcctgccctgcaccggc
aacagctccggcaccgcgtccttcaacgtcggcctcaagatccagacgcgcaacaacaag
ccgctctcgggcacacccattcgcctcaacttcaaaaaggaatgcgcccacagaggtgtg
tatgatatagacgcttccaaccctacttcactaacaactttgcaagaatgcagcttgaag
tgcggcaagaacggctactgcaacgatcaccacatctgcaagtgcaacgtgggctacacg
ggccaatactgcgagacggccttctgttttccgcagtgcctcaacggcggtaactgcact
gctccgtccgtctgcacctgtccggagggctaccaaggcacgcagtgcgagggtggtatt
tgcaaagacaagtgcttgaatggcggcaagtgcatacagaaggacaagtgccagtgctcc
aagggttactacggcctacattgcgagtactccaagtgcgtgatcccctgcaagaacgac
ggccggtgcatcgggaacaacctgtgccgctgtcccaacggactacgaggcgatcactgc
gagatcgggcgcaagcagcgctccatctgcaagtgtcgcaacggcacctgcgtctcccac
aagcactgcaagtgccatccgggattctatgggcgccactgcaacggtcgcaagcgacat
atccaccgaaacaatgactccaagttctag

DBGET integrated database retrieval system