KEGG   Drosophila erecta: Dere_GG17656Help
Entry
Dere_GG17656      CDS       T01060                                 

Definition
GG17656 gene product from transcript GG17656-RA
Orthology
K01691  
WNT inhibitory factor 1
Organism
der  Drosophila erecta
Pathway
Wnt signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:der04310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 439 aa AA seqDB search
MTHQGTGCLVKWLYLVLIVHTLLCLGQIECRQNQNRNNNNNNKRADSSSSEEGHVNSSDL
LDNFADQDASFVSHGHQPRRGQRKKGGGGGSRHNRNEESGISLWINEQQLKMLTALYFPQ
GYSERLYAIHNSRVTNDLRDTTLYNFLVIPSEVNYVNFTWKSGRRKYFYDFDRLQTMDES
ILKAPTLSIRKSGRIPQEQKNFSIFLPCTGNSSGTASFNVGLKIQTRNNKPLSGTPIRLN
FKKECAHRGVYDIDASNPTSLTTLQECSLKCGKNGYCNDHHICKCNVGYTGQYCETAFCF
PQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDKCLNGGKCIQKDKCQCSKGYYGLHCEY
SKCVIPCKNDGRCIGNNLCRCPNGLRGDHCEIGRKQRSICKCRNGTCVSHKHCKCHPGFY
GRHCNGRKRHIHRNNDSKF
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgacacatcagggcaccggctgcctggtcaagtggttatatctggtgctgatcgtgcac
acgctcctctgcctcggccagatcgagtgtcgccagaaccagaatcggaataacaataac
aataacaaaagagcggactcgtccagctcagaggaaggccacgtcaactccagcgatctc
ctggacaactttgcggaccaggacgccagcttcgttagccatggccaccagccacgtcgg
ggccaacgaaagaaaggaggaggcggtggcagccggcacaatcgcaacgaggagagcggc
atctcgttgtggatcaatgagcagcagctcaaaatgcttacagcgctctacttcccacag
ggctactcggaacgcctgtacgctattcacaatagccgggtgaccaacgacctgagggac
accacgctgtacaacttcctggtaatcccctcggaggtgaactacgttaacttcacatgg
aagtcggggcgccgcaagtacttctatgactttgatcgcctgcagaccatggacgaaagc
attctaaaggcaccgacgctgtccattcgcaagagcggacgcattccgcaggagcagaag
aattttagcatattcctgccctgcaccggcaacagctccggcaccgcgtccttcaacgtc
ggcctcaagatccagacgcgcaacaacaagccgctctcgggcacacccattcgcctcaac
ttcaaaaaggaatgcgcccacagaggtgtgtatgatatagacgcttccaaccctacttca
ctaacaactttgcaagaatgcagcttgaagtgcggcaagaacggctactgcaacgatcac
cacatctgcaagtgcaacgtgggctacacgggccaatactgcgagacggccttctgtttt
ccgcagtgcctcaacggcggtaactgcactgctccgtccgtctgcacctgtccggagggc
taccaaggcacgcagtgcgagggtggtatttgcaaagacaagtgcttgaatggcggcaag
tgcatacagaaggacaagtgccagtgctccaagggttactacggcctacattgcgagtac
tccaagtgcgtgatcccctgcaagaacgacggccggtgcatcgggaacaacctgtgccgc
tgtcccaacggactacgaggcgatcactgcgagatcgggcgcaagcagcgctccatctgc
aagtgtcgcaacggcacctgcgtctcccacaagcactgcaagtgccatccgggattctat
gggcgccactgcaacggtcgcaagcgacatatccaccgaaacaatgactccaagttctag

DBGET integrated database retrieval system