KEGG   Drosophila erecta: Dere_GG17696Help
Entry
Dere_GG17696      CDS       T01060                                 

Definition
GG17696 gene product from transcript GG17696-RA
Orthology
K07204  
regulatory associated protein of mTOR
Organism
der  Drosophila erecta
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:der00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Dere_GG17696
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1858 aa AA seqDB search
MTSAVRVKSATAAVGVAVDESSGSSNGSIADQELSSGKETDLRILIRTRYENYTFARWDD
PILVIVDQLEHIERCQSSALENQVAIGRERSQDDSLNDLREVVNNIRQDHSLIPIVKHIE
QISDFQASNGQEQASLGCLRELIKIIRKEWPRDDFIQLRTKRIQSIQAQPPTESICFGEH
LRDDRCPLSLQTKRHKERIQAMMYERQTWRIRERMKTASVALVLCLNIGVDPPDVVKIQP
CSRLECWIDPSSVSPPKAMELIGSNLQMQYERWQPRARYKKCNDPTVDDVKKLCTSLRRN
AKGERILFHYNGHGVPKPTANGEIWVFNKTFTQYIPLSIFELITWMSAPSIYVYDCSNAG
IIINSFQPYAEQHEKELEKALAAAQQRGGVQQMVGGSGGAGNVAANQVQLPNQMVSYKNC
IHLAACAANEILPMNAQLPADLFTSCLTTPINIALKWYAMQEKLGMVPRIQSELIDKIPG
KVNDRRTMMGELNWIFTAITDTIAWNTLPRELFQRLFRQDLLVASLFRNFLLAERILRSH
DCTPVSLPALPPCYRHPMWKAWDLVVDLALQQLPEILDHNAPYRQLPFFEHQLTAFQVWL
DSESESRTPPEQLPIVLQVLLSQVHRLRALELLARFLDLGPWAVNLALGVGIFPYVLKLL
QSSTRELRPVLVFIWAKILAVDPSCQVDLVKEYKYFLSVLQDTSVSKEHRTLSAFVLSSI
VHNFLLGQTSALQGPLLSICLEQLNDGSWLLRQWLAICLGMLWQNFEKARWSGARDLAHE
KLYVLLRDSIPEVRAAAVFALGTFISSVTDRSEEQANNIDRIIAITMLETVGEDMSPLVR
MELAAALQWMVVLFESQFVAVYLAEHMRGHVSAASFVMCPDPRELTLSTHSLERHVTIRR
GASSSSISNMGGASTGSGTGSSSNPLGRSKSGSASSGGRGAAGAAGGTNSIPFQSIFTKL
WMGIFNLAQDPFPRVAAIAQEIVDHVRDTALCPIMAAKEATMANASEKCSSLSVSLPPSP
NTRVNYLGGGGAPGGAGATAESPPVGPTASSASHWAQKLRLSGSGACVAAGEPQTILQRK
LRTSSINDETDSGPAYSRGVAGAGAGLGLPSGPRESTHSARSSGSESNHYLEPGHSLTPI
VPTDFIPWAISYFTRPGKERYSSAEGPAEEGRQRYPVDRNSAELRRRRLRFLRNEFVRRH
AGRKHQELTDPYGFDVCVWNRKTQFTPSIVKLLPYEPQIAVAYREKVLVYDFQYNSVRTY
GAEALGGNSTGSSSGYGSGSGSSSSLNGSTPRKSGAHPSGGGSGFSAAPFARVSSIEFIN
AQDMALNLVAHEDGVVRVWQSPPPASSATSEDTPSKARLVTAWTALGQVNQHNHRQRSVA
SGGSIGKGADASGLSSGAIGSGGIVTAWQQCSQHLVIGGGGCRFIRIWDVERELKLADIP
LGRSETCARVLSPYLPNMRSDVILAGCDDGSVRLFDKRCSPQDARISVYRRHSAPILHAS
LRANVPVLVSGCTEGRISVADMRSSQSSISLNDVVHEWDAGGDVTAITSHQLGDTVACGN
ASKIVIYSLDGRQQKVLRTNEGFIGPKIGHPTWLYFHPYKVQLAFYKGCGKWKTDVDKNP
ETLVNARRFLAEPQMQSAVQHVRSSTRLPDLQPEDVQLMYTVCAFETAWHRPRRNSGSMP
DSSYESVWCNFFDVAALEALEFFEDLEYYWNDGYGYELTHRIACPAIADMFAAISSSEEK
RPRRANATLYFTHSGTLLKLLAHLGLARDRKPLTHKHFASERLWRTSQIDAFATNLAFLR
YDCDKEKPQVLVLHQERVVRLPGCPQDKDLCPLATLRRLYAKSVDHCDREEMCRVKAN
NT seq 5577 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtgccgtacgcgttaagtccgccactgccgcagtcggcgtcgcagtcgacgaa
agcagcggcagcagtaacggcagcatcgcggatcaggagttgtcttccggtaaggagacc
gacctgcgcatcctcatccgtacgagatacgaaaactatacattcgctcgttgggacgat
cccatactcgtgatagtggaccaactggagcacatcgagcgctgtcaatcctccgccttg
gagaaccaggtggccatcggccgggaacgatcccaggacgactctctgaacgacctacgt
gaggtggttaacaacataaggcaggaccactcactaatcccaatcgtgaagcacatcgag
caaatatccgacttccaagcgtctaacggacaggaacaggcctccctcggttgcttgagg
gagttgatcaagattattaggaaggagtggccccgggacgacttcatccaattgcggacg
aagcgaatacagagcatacaggcccagccgcccacggagagcatatgcttcggcgagcat
ctccgcgacgacaggtgcccgctctccctgcagactaagcggcacaaggaacgcatccag
gccatgatgtacgagcgacagacgtggcgtatccgcgagcgcatgaagacggcaagcgtg
gccctggttctgtgcctcaacatcggcgtggatccgccggacgtggtcaagatccaaccc
tgctcacggctagagtgctggatagatcccagctcggtgtccccgcccaaggccatggaa
ctcattgggagcaacctgcagatgcagtacgagcgctggcagccaagggccaggtataag
aagtgcaacgatcccaccgtggatgacgttaagaagctctgcacctccctacgccggaac
gccaagggggagcgcatactcttccactacaacggacacggagtgcccaagcccacagcc
aacggagagatctgggttttcaacaagaccttcacacaatacatccccctgagcatattc
gagcttatcacgtggatgtcagcgccctcaatttacgtgtatgactgctccaacgccggg
atcatcatcaattcgtttcagccatacgctgagcagcacgagaaagaactggagaaggcg
ctggccgccgcccagcagaggggcggagtccagcagatggtgggcggctcaggtggtgcc
ggcaatgtagccgccaaccaggtgcagttgcccaaccaaatggtcagttacaagaactgt
atacacctggccgcctgtgctgccaatgaaattctgcccatgaatgcgcagctgccggcg
gatctgtttaccagctgtctgacaacacccattaacatcgcgctcaagtggtacgccatg
caggagaaactgggcatggtgccgcgtatccagagcgaactgatcgataagattccaggc
aaggtcaacgaccggcgcaccatgatgggtgagctcaactggatcttcaccgccattacg
gacacgatagcgtggaacacacttcctcgcgagcttttccagcgcctgttccgccaggat
ctgctggtggccagcctgttccgcaacttcctgttggccgagcgcatcctgcgcagccac
gactgcactccagtttccctgcccgccctaccgccttgctatcgccatccgatgtggaag
gcctgggatctagtggtagatctggctctacagcaattgccggaaatcctggatcacaat
gcgccgtaccgccagttgccgtttttcgagcaccaactcacggccttccaggtttggcta
gacagcgaatcggagtcgagaacgccaccggaacagctgcccattgtgctgcaggtccta
ctgtcgcaggtgcaccgcctgagggccctagagctgctcgcacgctttctggatctcggt
ccgtgggccgttaatctcgccctgggcgtgggcatctttccatacgtgctcaagctgctg
cagagttctacgcgcgagctgcggcctgttttggtgttcatttgggccaagatcctggct
gtggatccaagctgccaggtggatctggtcaaagagtacaagtacttcctctccgtgctg
caggacacctccgtttccaaggagcaccgcacactctccgcctttgtactgtcctccata
gtgcacaacttcctgctgggacagacgagcgctcttcagggtccccttctgtccatttgc
ctggagcagctaaacgacggaagctggttgctgcgccagtggctagccatctgcctgggc
atgttgtggcagaacttcgaaaaggcacgttggtcaggagcacgcgacctggcgcacgag
aagctgtacgttctgctgcgggactccattccggaagtgcgagccgctgccgtcttcgcc
ttgggcacatttatcagctccgtgacggatcgcagcgaggagcaggccaataacatcgat
cgcatcattgccattaccatgctcgagaccgtgggcgaggatatgtcgccgctagtccgc
atggagttggccgccgctctgcaatggatggtagtactctttgagtcacaattcgtggcc
gtgtatctagctgagcacatgcgtggtcacgtctccgccgcctcattcgtgatgtgcccc
gatccccgggagcttacattatccacgcacagcctggagcgtcatgtgaccatacgcagg
ggagccagctccagctccatatctaacatgggtggtgcgtcaaccggctcggggacagga
tcatccagcaaccccttaggtcgctcgaagagtggctctgctagttcgggaggaagagga
gcagccggagctgcgggcggtactaacagcatacccttccagtcaatctttaccaaactg
tggatgggcatcttcaatctggcccaggatccgtttccccgtgtggcggccattgcccag
gagattgttgaccatgtgagggatacggcactgtgccccatcatggccgccaaggaagcc
accatggccaatgcctcggagaagtgcagtagcctaagtgtgagcctcccgcccagtcca
aatacgagggttaattacttgggtggtggcggtgcaccaggaggagctggagcaactgca
gaatcaccgcccgtcggaccaactgcctcgtccgccagtcactgggcccaaaagctacgg
ctatcgggcagtggagcttgcgtggctgccggagagcctcaaaccatactgcagcgcaag
ctgcgcaccagctccatcaacgatgagactgacagcggaccagcgtactccagaggagtg
gcgggcgccggagctggtctgggactgcccagcggaccgagggagagcacccattcggcg
cggagcagcggcagcgagagcaatcactacttggagccggggcacagcctcacgcccatt
gtccctaccgattttataccctgggccatttcctatttcacacggccgggcaaggagcgc
tacagcagcgccgagggaccagcagaggagggacgccagcgctacccagtggaccgaaac
tcagcggagctgcgacgcagaaggttgcgcttcctgaggaatgaatttgtgcgccgacat
gccggccgcaagcatcaggagctgaccgatccttacggcttcgatgtgtgcgtgtggaac
cggaagacacagttcacgccttcaatcgtcaagctgctgccttacgagccgcagattgca
gtggcctacagggagaaggtcctggtatacgacttccagtacaattcggtacgcacatac
ggcgccgaggctctcggcggcaactccactggctccagttccggttacgggtcaggttcc
ggctcatcttcctcgctcaatggcagcactccgcggaagtcgggcgcacacccaagtgga
ggaggaagtggattttccgccgccccctttgcccgcgttagtagcatcgagtttatcaat
gcccaggatatggcgctcaacctggttgcacacgaagacggagtggtgcgcgtctggcaa
tccccgccgccggccagctcggccacctccgaggataccccgagcaaggcccgattggtg
actgcgtggacagcactgggtcaggttaaccaacacaatcaccgccagcgcagcgtggct
tccggcggcagcattggcaaaggtgcggacgcatcgggactgtcgagcggtgcaattgga
tccggagggattgtgaccgcatggcagcagtgcagccagcatcttgtgataggcggcggt
ggctgccgatttatccgcatttgggacgtagaaagagaactgaaactggcagatattcca
ttgggccgcagcgaaacctgcgcccgggtgctatcaccctacctgcccaatatgcgttcc
gatgtgatcctcgccggctgcgacgacggcagtgtgagactgtttgacaagcgatgttcg
ccgcaggacgctcgcatctccgtttaccggcgccacagtgcccccattcttcatgccagc
ctgcgggcaaacgtaccggtgctggtctccggctgcaccgaaggtcggatcagtgtggcg
gacatgcggtccagccagtcctccatcagcctcaacgacgtagtgcacgagtgggacgcc
ggtggcgatgtgacggccataaccagccaccagctaggagacacggtggcctgcggcaat
gcctcaaagattgtgatctactcgctggacggacgacagcagaaggtgttgcggacgaac
gagggtttcattgggcccaagatcggtcaccccacgtggctgtattttcacccatacaaa
gtgcagctggcgttctataagggctgtggcaagtggaaaactgacgtcgataagaatccc
gaaaccttggtcaacgcacgcaggttccttgcggagccgcagatgcagtcagcagtgcag
catgtacggagcagcacccggctaccggatcttcagccggaggacgttcagcttatgtat
acggtgtgcgctttcgaaacggcctggcatcgcccgcgtcgcaactctggctcgatgcca
gattcgtcatacgaatccgtgtggtgtaacttcttcgacgtggccgcattggaggcgctg
gagttctttgaggatctggagtactattggaacgatggctacggctatgaactgactcat
cgcattgcctgtccggcaatcgcagatatgtttgcggccattagctcctctgaggagaaa
cggccgcgacgggccaacgccacgttgtactttacgcactcgggtacgcttctcaaattg
ctggcccacctgggattggcccgggataggaagccgctgacgcacaaacactttgcaagc
gagcgtctttggcgcacaagccagatcgacgcgttcgcgaccaacttggccttcctacgt
tacgattgcgacaaggagaagccgcaagtcctggtgctgcatcaggagcgagtggtgcgc
ctgcccggctgcccgcaggacaaggatctctgtccgctggccacgctgcgtcgcctttac
gccaagagcgtggaccactgcgaccgcgaggagatgtgccgagtgaaggccaactaa

DBGET integrated database retrieval system