KEGG   Drosophila erecta: Dere_GG17765Help
Entry
Dere_GG17765      CDS       T01060                                 

Definition
GG17765 gene product from transcript GG17765-RA
Orthology
K15759  
inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
der  Drosophila erecta
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Dere_GG17765
  Energy metabolism
   00920 Sulfur metabolism
    Dere_GG17765
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    Dere_GG17765
Enzymes [BR:der01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Dere_GG17765
    3.1.3.25  inositol-phosphate phosphatase
     Dere_GG17765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 355 aa AA seqDB search
MSEAKMNGRSIRIHRLPATIVAIILTIFLVYFLNFHQEERPAIYGMLRSENPNRVNLRKM
LIAAIQAAQRGGLEVLDVARSRQLKERSKGKTDEGVNDPFTDADGRSHCVMKQGLQRIFP
RVQIFSEEDKEHCKQAHGYDLDPTVLHETAQIPDVTVNAQDVTVWVDPLDATKEFTEELY
EYVTTMVCVAVAGRPIIGVIHSPFNGQTAWAWVGNSMSEYLSNLHPRHSANHQAPIITVS
RSHTAGAKDLARGIFGEEVSLLTAAGAGYKVLQVVANNATAYLHTSKIKKWDICAGDAIL
HALGGTMTTLNDQLINYGPGESPVNKEGLLATLEQHDEYMDKLSKYREAHNGKLA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggccaagatgaacggacgctccattcgcatccaccggctgccggccaccatt
gtggccattattctgaccattttcctggtctattttctcaatttccatcaggaggagcgg
ccggcgatctacggtatgctgaggagtgagaatcccaaccgcgtcaatctccgcaagatg
cttatcgccgccatacaggccgctcagcgtggcgggctcgaagttctagacgtggcccgg
agtcgccagcttaaggagcgcagcaagggcaagacggacgagggcgtcaatgatccgttc
acagatgccgacggcaggtcacattgtgtgatgaagcagggcctccagcgaatctttccc
cgcgtacaaatcttctccgaggaggacaaggagcactgcaagcaggcgcacggctatgat
ctggatccaacggtcctccacgaaaccgcacagattccggatgtgaccgtaaatgcgcaa
gatgttactgtttgggtagatccgctggatgccaccaaggagttcaccgaggagctgtac
gagtacgtgaccaccatggtgtgcgtggcggtggccggaaggcccatcatcggcgtgatc
cacagcccgttcaatggtcaaacagcctgggcgtgggtgggcaactcgatgtccgagtac
ctgtccaatctgcatccgcggcattcggcaaaccatcaggcgcccattatcacagtgtcg
cgatcccatacggcgggagccaaggatctagcgaggggcatctttggcgaggaagtcagc
ctgctgacggcggcgggagctggctacaaggtgctccaggtggtggccaacaatgccact
gcctatctgcacacgtccaagatcaagaagtgggacatttgcgccggcgatgccattctg
cacgcattgggcggcacaatgaccacactgaacgaccagttgatcaactacggaccaggg
gaatcgccagtcaataaggagggtctgctggccaccttggagcagcatgacgagtacatg
gacaagctttccaaatatcgcgaggcgcacaatggcaagctggcgtag

DBGET integrated database retrieval system