KEGG   Drosophila erecta: Dere_GG18067Help
Entry
Dere_GG18067      CDS       T01060                                 

Definition
GG18067 gene product from transcript GG18067-RA
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
der  Drosophila erecta
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dere_GG18067
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dere_GG18067
  Amino acid metabolism
   00310 Lysine degradation
    Dere_GG18067
Enzymes [BR:der01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Dere_GG18067
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 469 aa AA seqDB search
MTGIISIVTRRLPQTLGMRALRSNELKRCIRQYSRLVACAAQQQQLFRQDGSNRCQEATR
LLTWQGIHTTSSMWSEQTINVPPFADSIAEGDIKFTCKVGDSFAADEAVMEIETDKTTVA
VPAPFAGTLTDILVKDGDTVKPGQALFKIKPGAAPAKAAAPAAAAPAPAAPKAAPAPAAA
AKPAPPPPAAGAPKPPPPPPPKAAPRPAPPAPVASLKPAVAQVKVPPADGSRQILGTRSE
QRVKMNRMRQKIAARLKDAQNTCAMLTTFNEIDMSYAMDFRKQNLDAFTKKYGIKLGFMS
IFAKASAYALQDQPVVNAVIDGTDIVYRDYVDISVAVATPRGLVVPVIRNVEGMNYADIE
IALAGLADKARRDAITVEDMDGGTFTISNGGVFGSLMGTPIINPPQSAILGMHGIFERPI
AVKGEVKVRPMMYIALTYDHRIIDGREAVLFLRKIKAAVENPAIIVAGL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgacgggaataatttcgatcgtaacgagacggctgccccaaacgctgggaatgcgagcc
ctgcggagtaatgagctgaagcgctgcatccgccaatactcacggttagttgcctgtgcc
gcgcagcagcaacaactgttccgccaagatggctccaatcgctgccaggaggccaccagg
cttctcacctggcagggtatccacaccacgtcgagcatgtggtcggagcagaccatcaat
gtgccaccctttgcggactccatcgccgagggtgacatcaagtttacttgcaaggtgggt
gattcattcgccgctgacgaggccgtcatggaaatcgagaccgacaagacgacagtggct
gtgccagctccctttgccggtactctgaccgacattctggtgaaggatggcgacaccgtc
aagcccggacaggctctgttcaaaattaagcccggtgcagcgcccgccaaggcagctgct
ccagcggctgctgcacccgctcctgctgcccccaaagcagccccagctcccgctgctgca
gccaagccggctcccccaccaccagccgccggcgcacctaagccaccaccaccgccacca
ccaaaggcagcccctcgaccagcaccacctgctccagtggcctcgctcaagccggccgtc
gcccaggtgaaggtgccaccagcggacggatcgcggcaaatcctaggcacaaggtccgag
caacgtgtcaagatgaaccgcatgcgtcagaagattgccgcccgcttgaaggatgcccaa
aacacatgtgctatgctcaccacttttaacgagatcgatatgagctatgccatggacttc
cgtaagcagaatttggatgcgtttactaagaagtatggcattaagcttggctttatgtcc
atctttgcgaaggctagtgcctatgcgctgcaggatcagcccgtagtgaacgccgtcatc
gatggcacggacatcgtgtaccgcgactacgttgatatctctgtggccgtggctacgcct
cgtgggttggtggtaccggtcatccgaaacgtggagggcatgaactatgcggatatcgag
atcgcgctggccggtttggccgacaaggcaaggcgggatgccatcaccgtggaggacatg
gacggcggcaccttcaccatcagcaatggaggagtgtttggatccctgatgggcacgccc
atcatcaatccgccacagagtgccattcttggtatgcacggcatctttgagcgaccaatt
gctgtcaagggcgaggtcaaggtacgaccaatgatgtacatcgccctgacctacgatcac
cgaatcattgatggacgtgaggcggtcctgttcctgcgaaaaataaaggctgctgtagag
aacccagcaatcattgttgccggattgtaa

DBGET integrated database retrieval system