KEGG   Drosophila erecta: Dere_GG18154Help
Entry
Dere_GG18154      CDS       T01060                                 

Definition
GG18154 gene product from transcript GG18154-RA
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     Dere_GG18154
Protein kinases [BR:der01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   Dere_GG18154
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 919 aa AA seqDB search
MYRLEDTNSGGVMDKNKQKLSAYGSSGGSVAVDAAQGSGSGGGRQRHAPLYGRFVDAEDL
PATHRDVMHHHSSPSSSSEVRAMQARIPNHFREPASGPLRKLSVDLIKTYKHINEVYYAK
KKRRAQQTQGDDDSSNKKERKLYNDGYDDDNHDYIIKNGEKFLDRYEIDSLIGKGSFGQV
VKAYDHEEQCHVAIKIIKNKKPFLNQAQIEVKLLEMMNRADAENKYYIVKLKRHFMWRNH
LCLVFELLSYNLYDLLRNTNFRGVSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENI
LLCNPKRSAIKIVDFGSSCQLGQRIYHYIQSRFYRSPEVLLGIQYDLAIDMWSLGCILVE
MHTGEPLFSGCNEVDQMNKIVEVLGMPPKYLLDQAHKTRKFFDKIVADGSYVLKKNQNGR
KYKPPGSRKLHDILGVETGGPGGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTRVTPYYA
LQHNFFKRTADEATNTSGAGATANAGAGGSGSSGAGGSSGGGVGGGLGTSNSSSGAVSSS
SAAAPTAATAAATASGSSGSGSSVGGGSSAAQQQQAMPLPLPLPLPLPLPPLAGPGGASD
GQCHGLLMHSAAANAMNNFSALSLQPTAHPPPSLANSHHSTNSLGSLNHISPGSSSCNNN
SSSSNNNTRHSRLYGSNMVNMVGHHNSSSNSGSSSSSNHNSISYPHAMECDPPQMPPPPP
NGHGRMRVPAIMQLQPNSFAPNSVPYYGNMSSSAAAAAAAAAAASHLMMTDSSVISASAA
GGGQGGGNPGQNPVPQSAAAFLFPSQPAGTLYGTALGSLSDLPLPLPMTLPMPVPLQLPP
SSSSVSSGSAAVGSGGVGVGMGVGVVGQRRHINGPAAQVGISQSVGSGSSSATGASSSDA
SSSSPMVGVCVQQNPVVIH
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgtatagattagaggatacgaatagcggcggcgttatggataagaataaacagaaactg
tccgcctatgggtccagcggaggcagcgtcgccgtcgacgcagcgcagggcagcggaagc
gggggcggaagacagcgccacgcccccctctacgggcgattcgtcgacgcagaggatctg
cctgccacgcaccgggatgtcatgcaccatcactctagtccctcgtcttcgtcggaggtg
cgcgccatgcaggcccggattcccaaccactttcgggagcccgcctcgggacctttgcgc
aagctgagtgtcgatctgataaagacctacaagcacatcaacgaggtttactatgcgaaa
aagaaacgtcgtgcccagcagacgcaaggagacgacgactcatctaacaaaaaggagcga
aaactttataacgacggctacgacgacgataatcacgactatataatcaagaatggcgaa
aagtttttggatcgctacgagatcgactctctgatcggcaaaggcagctttggccaggtg
gtgaaggcttacgaccacgaagagcagtgccacgtggcgatcaagataattaagaataag
aaaccgttcctaaaccaggcacagatcgaggtcaagttgctcgagatgatgaaccgggcg
gatgccgaaaacaaatactacatcgttaagctcaagcggcacttcatgtggcgcaaccac
ctgtgcctggtgttcgagctgctctcatacaacctgtacgacctgctgcggaacaccaac
ttccggggcgtttcgctgaacctcacgcgcaagttcgcccagcagctgtgcaccgcactg
ctcttcctcagcacccccgaactgaacataattcactgtgatttgaagcccgagaacatc
ctgctgtgcaacccgaagcgctcggcgatcaagatcgttgactttggcagctcctgccag
ttgggacagcggatctaccactacatccagtcccgcttctaccgctcgccggaggtgctg
cttggcatccagtatgacctggccatcgatatgtggtcactgggctgcatcttggtcgag
atgcacaccggcgagccgctcttctccggctgcaacgaggttgaccagatgaacaagatc
gtcgaggtgctgggcatgccgcccaagtatctgctcgaccaggcgcacaagacccgcaag
ttcttcgacaagatcgtggccgatggctcctatgtgctgaagaagaatcagaacggcagg
aagtacaagccaccaggatcccgcaagcttcacgacatcctcggagtggaaacaggcggt
ccagggggcaggcgtctcgatgagcctggccactccgtctcggactatctgaagttcaag
gacctaattctgcgcatgctcgactttgaccccaagacacgggtcacgccctactatgcc
ctgcagcacaacttctttaagcgcacggcagacgaggcaaccaacacgagcggcgcgggc
gccacagcgaacgcaggagccggtggctccggatccagcggagcaggaggctccagtggc
ggaggcgtcggcggcggcctcggaacgagcaacagcagtagcggtgcggtctcctcatcc
agtgcagcggctccgacggcggcgacagcagcggccacggcctcaggatcttccggttcg
ggttcaagtgtcggcgggggctcctccgcagcgcagcaacagcaggcgatgccgctgccc
ttaccgcttcctttgccactgccgttgccaccactcgcgggtcctggcggtgcgtcagat
ggccaatgtcacggcctgcttatgcattcggcggcggccaacgcgatgaacaacttctcc
gctctgagcctgcagcccaccgcccatccgccgccatcgctggccaatagccaccacagc
accaacagcctgggcagcctgaatcacatcagtcccggtagcagcagctgcaacaacaac
agcagcagcagcaacaacaacacacgccacagtcgtctgtacggcagcaacatggtcaac
atggtggggcaccacaacagcagcagcaacagcggcagcagcagcagcagcaaccataac
agcatcagctatccgcacgccatggaatgtgatccgccgcagatgccgccaccgccgcca
aatggacatggcaggatgcgggtgccggcgataatgcaactgcagccgaacagctttgcg
cccaattcggtgccctattatggcaacatgtcctcgtctgctgcggcggcggcggcggca
gcagctgctgcctcgcatcttatgatgaccgattcgagtgtgattagcgcctcggcggcg
ggcggtggccagggcggcggcaatcccggccagaatccggttccgcagtcagctgccgcc
tttctcttcccatctcagcccgccggaacgctatatggaacggcgctcggctcgctaagc
gacctgccactgccgctgccgatgacactgcccatgcccgtgcccctgcaactgccgccc
tcgtcgtcgtccgtctcctcaggatcagcagcagttggatctggaggagtgggtgtgggt
atgggagtcggcgtggttggccaaagacggcacatcaacggacccgccgcccaggtgggc
atctctcaaagtgtcggcagtggcagcagctcggccaccggggccagcagcagcgatgcc
tcctcgtcgtcgcccatggtgggcgtttgtgttcaacagaatcctgtagttatacattag

DBGET integrated database retrieval system