KEGG   Drosophila erecta: Dere_GG18164Help
Entry
Dere_GG18164      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein
  KO
K08865  PDZ-binding kinase [EC:2.7.12.2]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dere_GG18164
Protein kinases [BR:der01001]
 Serine/threonine kinases: Other
  TOPK family
   Dere_GG18164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RIO1 BUD22 APH DUF1510
Motif
Other DBs
NCBI-GeneID: 6549771
NCBI-ProteinID: XP_001977591
FlyBase: FBgn0110380
UniProt: B3NWX1
Position
Unknown
AA seq 393 aa AA seqDB search
MDTPGRKLRNLHMENIQNSSTPINVPPSPMLKTLGHGTGIRVYRLDRSPRLGEIRSPWAV
KRITQNMRVKKDTLFNERIVHEADILRKLKHPNIVGFRGVVTNDEGINTLALEMCTTSLG
SILEERHDEDLGPLPAKNTYKMIMDVALALDFLHNKASLLHGDLKSFNVLVKGEFEICKL
CDFGVSIPLDEQGEVNFQKNPGLRYVGTSLWCAPEVVDEVDVIDSKADIFSFGLVIYETL
ALVPPHTLELDAALGEDMDNSHELPTDTEKVQRKKLDFSSDERKNGLPSAIEEHTDNDMS
HDDDDEDDDEEEEEEEDDDTKENDISDITLNNLHSAYGTRPPLPVAFQLSDDYNCIVELF
YLCTNALSEDRPAAKTIWQCLENNAANVATGSD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggacacgccaggccgcaagctgagaaatttgcacatggagaatatccagaacagcagc
acgcccatcaacgtaccgccctcgccgatgctgaagaccctgggccacggcactgggatc
cgggtatatcgcttggaccgctcgccccgtctcggcgaaatccgttcgccatgggccgtc
aagcggatcacgcagaacatgcgggtcaagaaggacacgctcttcaacgagcggattgtc
cacgaggccgatatcctgcgcaaactaaagcatccaaatatcgtgggattccgaggcgtt
gtcaccaatgacgagggcatcaacacattggcactcgaaatgtgcaccacttcgctgggc
tccatactcgaggagcgacacgacgaggatctcgggccgttgccggccaaaaatacctat
aagatgatcatggacgtggccctggcactagattttcttcacaacaaagcgagtctcctg
cacggcgacctcaagtcctttaatgtcctggtcaagggcgagtttgagatctgtaagctg
tgcgattttggagtctctattcctctcgatgagcagggcgaggttaatttccaaaagaat
cccggactgcgctatgtgggaactagcctctggtgcgctccggaggttgtggacgaagtg
gacgtcattgacagcaaagcagacatcttcagctttggcctggttatctacgaaaccctt
gctctggtgcctccacataccttggagctggacgcagcacttggagaggatatggacaat
tcccacgaattacccaccgacacggagaaggtgcaacgcaagaagttggacttctccagc
gatgaaaggaaaaacgggttaccttctgcaatagaagaacatacagacaacgatatgagt
cacgacgacgatgacgaggatgatgatgaggaggaggaggaggaagaagatgatgacacc
aaggagaacgacatctccgacattacactgaacaaccttcattccgcttatggtacacgc
ccaccattgccagtggcctttcagctcagcgacgattacaactgcatcgtggagctgttt
tatctgtgcacaaatgctttaagcgaggatcggccagcggccaagaccatttggcagtgc
ctggagaacaatgccgcaaatgttgcgacaggaagcgattag

DBGET integrated database retrieval system