KEGG   Drosophila erecta: Dere_GG18299Help
Entry
Dere_GG18299      CDS       T01060                                 

Definition
GG18299 gene product from transcript GG18299-RA
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
der  Drosophila erecta
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:der00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dere_GG18299
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1287 aa AA seqDB search
MERRRFNLSSMSPMADSTRIDASLISNRPTATSFLRGLSPKGSNISRNGSRTPERSLMNR
TATSPSAISRQKLNLSQVDPRTFADVHSSGLASRIVAYHESSLGGRSGLQRSMSACNLYN
PLTQPRRAPASPMPYRSRAPTLSITQIAPPERSFYSGNTLPSLLRSNSLAGVVQKASEQE
QLSRENRPIMHPPHPQHESEPTRSVLEELKEISRKRINTGDTQQAHDFTKRSCQRSVDFV
DNHRHQQQLHHLQQQQNQPFKRQRELTVSVPLRHHSTSVSASPPALQHMQSNGNTSPTQS
PEQVAKRPNCSYSNDIASSLSSSWRHSNKRKLLDMREKFQHSKNDTLASGGSSPENSPEN
VAKIQRKVDAEIVGKALSMPSPAVAAVPASRSISAPPMQKTDQQSVVVPQVTEKPKLTLF
NARQSETKTDQPRPDLSSPEVDAGEYAGIQFVKPKQQNSMLGVRNPSVERTHKTKLAIML
SGLKGELYQGEPDELDAPAPKSTSAPVTLPTPIKPIIAPVTTSTTTVTSTVTTLTSAPSK
PVILSNQVIKPADVPNTNTTGSVPKLVLGQPAPPASTEQTPPKPTDKVPAAQADNPAKFE
LPGKPVSPATSSQPLISFNTPKSTAAPSFSFGSVTNTTSSTTTNITNNTTSKPIFSFGQA
PVNGPTVGGLPGFKIDTSTTTLASSTNPGTPVTSTTTFGAAAPKTTSTVAPTTTAVLSFG
QPNSTVLGTATSKSPTTTTMPSFGAANTAVKPMFLFGQSGNLSSGTPTTNGSDAAVAKPA
VFNLGGSTTQAATAAPTPVFGSLSIPLGGGFMSPVAIKSEATKPGIFGNAVKPPANVAAT
TAAELPKPFGFPATTTTAGGGSSATNLFTFGGTTTSKATEPAEASKNNLFGQSATTSTAF
AFGGAAANAGNGGSKDNKSMFAFGGGENNSVAKPSGVFGFGGTDKSAPPVFGSGTTSVTS
ATATSTNSAFGFSTAQKPETPMFGSGSTQQSSTPAVAATKPFTFGVGTAQGPAPSNSTAS
GGFSFAAVAARNSTEPTETNLFGSPANASKPSFNFGGNTATQAGAAGSPAGGFSFTKAAK
KEDSAGTNMFGSPNIVVVKPNFSFSSNNPTTQSAAPAAAPSFGGFGTPAAAAPTAASTNQ
NKPFAFGGSTPASAATPLGGNLFANAVSATQNQPKPGVFSFGSTKSTASATAGNAPFSFG
GASAGGIASPPSNQGLNTAKPFSFGGAGGTPAPNVFGSPAPAPPASNPAGGFSFGGASPA
QQANAGNLFAPTPEGRPIRKATRRLQK
NT seq 3864 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtcgtcgatttaacttgagcagcatgtcacccatggcggattccacgcggatt
gacgcgtcgctgataagcaatcgtccgacggccactagtttcctgaggggactgagtccc
aaggggtcgaatatctcgcgcaatggctcacgcactccggagaggtccttgatgaaccgc
actgccacatcgcccagcgccatatcgcgacagaaactgaacctcagccaggttgatccc
agaacttttgccgatgtgcatagcagcggactggcatcccggatcgtggcctaccatgag
agcagcttggggggacgcagtggtctgcagcgcagcatgtccgcctgcaatctgtacaac
ccactgacgcagccccgcagagcgcccgcttccccgatgccctacaggtcaagggcgccg
acgctttcgataacgcagattgcaccaccggaacgtagtttttattccggcaacacgctg
ccaagcttgttgcgctccaactctttggcaggggtagtgcaaaaggccagcgaacaggag
cagctttcgagggagaatcgaccaatcatgcacccacctcatccacagcatgagagcgag
ccaactagaagcgtgctggaggagctaaaggagatctcccggaagcgcattaacactgga
gatacgcagcaggctcatgactttacgaaaaggagttgccagcgaagtgtggactttgtg
gacaatcaccgtcatcaacagcaactacatcatttgcagcaacagcagaatcagcccttt
aaaaggcaacgagagctgacggtatcagttccccttagacatcattcgacatctgtgtcg
gcttctcctcctgcgttgcagcatatgcagtcgaatggaaacacctctccaacccaatct
ccggagcaggtggccaaacggcccaactgtagctacagcaacgacatcgcttcctcgctg
agttccagttggcgtcacagcaacaagaggaagctgttggacatgcgagaaaagtttcag
cacagcaaaaacgacacactagctagtggaggaagttcacctgagaactcgcccgaaaat
gtggccaaaatacaacgtaaagttgatgcagaaattgttggcaaggcattgagcatgccc
tctccggctgtggcggcagtaccggcatcccgatccatttcggcacctcccatgcaaaag
actgaccagcaatctgtagtggttccgcaggttacggaaaaacctaagcttaccctcttc
aatgcgcgacagtccgaaacgaaaacggaccaaccgcgaccggatctgagtagcccggaa
gtagacgctggcgaatatgcgggcattcagttcgtaaagcccaagcagcagaattccatg
ctaggcgttaggaaccctagcgtagaacgaactcacaagaccaaactagctattatgcta
agtggattgaagggcgaactgtatcagggtgaaccggacgaactagatgccccagcgcca
aagtcaacgtcagcgcctgtgactcttcctacgcccatcaaacccatcatagctcctgta
accacatccactacgaccgttacttccaccgtaaccacattaacttctgcgcccagcaag
ccggtaatacttagtaaccaggttataaagccagccgatgtgccaaacacgaataccact
ggctcagtgcccaaacttgtacttggtcagcctgcgccgcccgcttcaacagaacaaaca
ccaccaaaacccaccgacaaggtcccggcagcacaagcagataacccagccaagtttgag
ctgccaggcaaacccgtctctccagcaacatcatctcaaccactaatcagttttaacaca
ccgaaatccacagcagcaccctcattctcatttgggagtgtgaccaataccacaagtagc
actactaccaatattactaataacaccacctcaaagcccatattctcgtttgggcaagcg
cctgtcaatgggcccacagtaggcggtctccctggattcaaaatagacacttcaacaacg
actctggctagttctactaaccctggcacaccggtaacatctacaactacattcggagcg
gcagcgcccaaaacgacgtctactgttgcacccactacaacagcagtcctcagtttcggc
cagccgaattcaacagtattaggcaccgccacaagcaagagtccaacaacaacaacgatg
ccatcatttggagcagcaaacactgcagtcaaaccaatgtttttgtttggacaatcgggc
aatttaagttcaggaactccaacaaccaacggaagcgatgcagctgtggccaagccggct
gtattcaatttggggggtagcaccactcaagcagctacagctgcaccgacaccggtattt
ggaagtctttccatacctctaggtggaggttttatgtcacccgtggccatcaaatccgag
gcaactaagcctggcatctttggcaacgcagtgaagccaccagctaatgtagcagcaaca
accgccgcagagcttcccaagccatttgggttcccagctacaacaaccacggctggtgga
ggctcgtcggccacaaatctctttacatttggagggacgaccacttcaaaggcaacggaa
ccagctgaagcaagcaagaacaatctttttggacaaagtgcaaccacaagtacggccttt
gcatttggaggagcagcagccaacgcaggaaacggtggaagtaaggataacaaatcaatg
tttgcatttggcggaggtgaaaacaactcggtggccaagccaagtggggtatttggcttt
ggtggcacggacaagagtgctccacctgtctttggcagcggaacaacatcggtaacatct
gccacagcgacgtcaacaaacagcgcctttggatttagcacagctcagaagcccgaaaca
cccatgtttggaagtggatcaacgcaacagtcttcgacaccagcagtggcagccaccaaa
ccttttacatttggtgttgggaccgcgcagggtcctgcaccgtcaaattctacagcttca
ggaggattctcgtttgccgccgttgcggccagaaatagcacagaacccacagaaacaaat
ttgtttggcagccccgccaacgccagcaaaccaagcttcaactttggaggaaacaccgcc
acccaggccggagcagcaggatcaccagctggtggtttctccttcaccaaggccgccaag
aaggaggactctgctggcaccaatatgtttggaagccccaacatcgtagtggtaaaacct
aattttagcttttcaagcaacaatccgaccacacaatcggcagctcctgctgcagcacct
agctttggcggattcggtactccagcagcggctgcgccaacagccgcttcaactaatcag
aacaagccctttgcatttggaggtagcactccggcttctgccgcaactcccttgggcggc
aacctgtttgccaatgcagtgtctgccacccaaaaccaaccgaagccgggagtcttctca
tttggtagcactaagagcaccgccagcgccacagccggcaatgctcccttctcttttggc
ggcgcatctgctggcggcatcgcctcgccgcccagtaatcagggcttaaataccgcaaag
cccttcagctttggtggcgccggcggcactccagccccgaatgtcttcggaagtccagcc
cctgctccgccagcaagcaatcctgccgggggcttcagcttcggcggtgccagtccagct
caacaagcgaatgctggtaacttgtttgcccccacgccggagggtcgtccaatacgtaag
gccactaggcggctgcagaaataa

DBGET integrated database retrieval system