KEGG   Drosophila erecta: Dere_GG18305Help
Entry
Dere_GG18305      CDS       T01060                                 

Definition
GG18305 gene product from transcript GG18305-RA
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
der  Drosophila erecta
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:der00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    Dere_GG18305
   04068 FoxO signaling pathway
    Dere_GG18305
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    Dere_GG18305
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dere_GG18305
Protein kinases [BR:der01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dere_GG18305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 396 aa AA seqDB search
MSKNKLNLVLPPVNTEATVAAATVAPTPPFKTPSGTDTHSLLGKPKTSIDALTETLEGLD
MDDTERKRIKVFLSQKEKIGELSDEDLEKLGELGSGNGGVVMKVRHTHTHLIMARKLIHL
EVKPAIKKQILRELKVLHECNFPHIVGFYGAFYSDGEISICMEYMDGGSLDLILKRAGRI
PESILGRITLAVLKGLSYLRDKHAIIHRDVKPSNILVNSSGEIKICDFGVSGQLIDSMAN
SFVGTRSYMSPERLQGTHYSVQSDIWSLGLSLVEMAIGMYPIPPPNTATLESIFADNAEE
SGQPTDEPRAMAIFELLDYIVNEPPPKLEHKIFSTEFKDFVDICLKKQPDERADLKTLLS
HPWIRKAEVEEVDISGWVCKTMDLPPSTPKRNTSPN
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagaacaagctgaatctggtgctgccgccggtaaatacggaggcaactgttgcc
gccgccacagtggcgccgacgccgccgtttaaaaccccctcgggcacagacacacacagt
ttgctggggaagcctaagacgagcatcgatgcgctgacagagacgctggagggcctggac
atggacgacacggaacgcaaaaggatcaaggtgtttctcagccagaaggagaagatcggc
gagctgtcggacgaggatctggagaagctgggcgaactgggatcgggcaatggcggcgtg
gtgatgaaggtccggcacacgcacacacacctgatcatggccaggaaacttatccatctg
gaggtgaagccggcgattaagaaacagatcctgcgcgaactgaaagtattgcacgaatgt
aatttcccacacattgtcggtttctatggcgccttctacagcgacggcgagatcagtata
tgcatggagtatatggacgggggatcgcttgatctgatcctcaagcgggccggtcgaata
ccggagtccattctcggcaggatcacgctggcagtactcaagggattgagctacctgcgc
gacaagcacgccatcattcaccgtgacgtgaagccaagcaatatccttgtcaacagtagc
ggtgagatcaagatctgtgatttcggcgtctccggccaactaatcgactcgatggccaac
tcctttgtgggcacccgtagctatatgtcgccggagcgattgcagggcacccactactcc
gtgcagtcggacatctggtcgttgggcctgtcgctggtggagatggccatcggcatgtac
cccatcccgccgccaaataccgccaccctggagtcgatattcgcggacaatgcagaggag
agcggccagccgacggacgagcctagggcaatggccatcttcgagctgctggattacatt
gtgaacgaaccgccgcccaagctggagcacaagatattctccaccgagttcaaagacttt
gtggacatctgcctgaagaaacagcccgacgagcgggccgatctcaagaccctgctgagt
catccatggatacgcaaggcggaagtggaggaggtggatatatccggctgggtgtgcaag
acaatggatctgccgccgtcgacgccaaagcgtaatacgtcgcccaactag

DBGET integrated database retrieval system