KEGG   Drosophila erecta: Dere_GG18417Help
Entry
Dere_GG18417      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
der  Drosophila erecta
Pathway
der00600  Sphingolipid metabolism
der01100  Metabolic pathways
Module
der_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dere_GG18417
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     Dere_GG18417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 6551618
NCBI-ProteinID: XP_001977121
FlyBase: FBgn0110632
UniProt: B3NUD3
Position
Unknown
AA seq 649 aa AA seqDB search
MTANTATSEENLLRNGGQPQEPSTPTSDTEVGGGTPTELSEIFFVDNSRRKQSIKIQVKL
CPEGVYLRRETDEDDHINEQLIRIDDIIGSRYGPRLKKRARGGLNSCRNPNVSGQEANPE
PDRDNSAYLYIYAYLKKEKPLRRVQTLRILRFRSSNDYAVNLQTAELWHHTIRKHKHGNA
SSSPVDGGKQLLILLNPKSGSGKGRELFQKQVAPLLTEAEVQYELQITTHPQYAKEFVRT
RMDLMERYSGIVVASGDGLFYEVLNGLMERMDWRRACRELPLGIIPCGSGNGLARSVAHH
CNEPYEPKPILHATLTCMTGKSTPMDVVRVELAPRDKHFVLYSFLSVGWGLIADIDIESE
RLRSIGAQRFTLWAIKRLIGLRSYKGRVSYLVAKGKMEPPVEAAQEAREIPGESDQQKRP
SATAAVIRSSLPLNAGEFHDLPEEEADLDGEQFADAISLDRSVYRQHADSWHSAMSRRTA
YYSLGGPSLRSNRSRMSISQRIEAANAEFAEKVPTGTIPGLQMPLPSSEGWICEDGEFVM
VHAGYTTHLSTDVFFAPESRLDDGLIYLVIIRSGVSRHQLLNFMLSLNTGTHLPIGEDPF
IKVVPCRAFRIEPSSSDGILVVDGERVDYGPIQAEVMPGLINVMTTSGQ
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgacggccaacacagcgacgtcggaggaaaatctgctgcgaaatggcggacagccgcag
gagccctccacgcccacctcggatacggaagtgggcggtggcacgcccaccgaactgagc
gagatcttctttgtggacaacagccggcgcaagcagagcatcaaaatccaggtgaaactc
tgcccggaaggagtctacctgcgccgcgaaaccgacgaagatgaccacatcaatgagcag
ctcatcaggatcgatgatatcataggatcgcgctacggtccgcgattgaagaagcgagcg
aggggtggcctaaactcctgccggaatccaaatgtttcgggccaggaggcgaatcccgaa
ccggatagagataatagcgcttatttgtacatctatgcgtatctgaagaaggagaaacca
ctgcggcgcgtccaaacgctcaggattctacgcttccgatcgagcaatgactatgcggtg
aatctgcagaccgccgagctatggcatcatacgatacggaagcacaagcatggcaatgcc
agtagttcgcccgtcgatggtggcaagcagctgctcattctactgaatccgaaatccggt
tccgggaagggtcgtgagctgttccagaaacaggtggcacctctgctcacggaggcagag
gtgcagtacgaactccagatcaccacacatccgcagtatgccaaggagttcgtgcggacc
aggatggatctgatggagcgctattcgggcattgttgtcgcctccggcgatggcctgttc
tacgaagtgctcaatgggctgatggagcgcatggattggcgcagagcctgcagggagctg
ccactgggcatcattccatgtggctccgggaatggcctggccagaagtgtggcccatcat
tgcaacgagccatatgaaccgaagcccattctccacgccaccttgacttgcatgacggga
aagagcacacccatggatgtggtcagagtggaactggcgccgcgggacaagcacttcgtg
ttgtactccttcctgtcggtgggctggggtctgatagccgatatcgacatagaaagcgag
cggttgcgatcgattggagcgcaaagatttacgctatgggccatcaagaggttgattggc
ctgcgcagctacaagggcagagtgtcctacctagtggccaagggcaaaatggaaccacca
gtggaagcggcgcaggaggctcgcgagattcctggagaatcagaccagcagaagcgaccc
tcagcgactgctgcagtaatccgttcttctctgcccttgaatgccggggaattccatgat
ctacccgaggaggaggcggatctggatggagaacagtttgcggacgccatatccctggac
cgttcggtttatcgccagcacgccgacagttggcactcggccatgtccaggagaacggcc
tattactccctgggaggacccagtttgcgatccaatcgcagccggatgagcataagccag
cggatcgaggcagccaatgcggaattcgcagagaaggtgcccacgggcaccattccggga
ttacagatgccactgcccagtagcgagggttggatctgcgaggatggtgagtttgtgatg
gtccatgccggatataccacccatctctccaccgacgtcttctttgcgcccgaatcccgg
ctggacgatggcctcatctacctggtgatcatccggagtggcgttagtcgccatcagctg
ctcaacttcatgctgagcctgaacacaggcacccatctgcccatcggcgaggatccgttc
atcaaggtggtgccctgccgggcattccggatcgagccgagcagctccgacggcatcctg
gtggtggacggcgagcgggtggactacggacccattcaggcggaggtaatgcccggcctg
atcaatgtgatgaccaccagtggtcagtag

DBGET integrated database retrieval system