KEGG   Drosophila erecta: Dere_GG18463Help
Entry
Dere_GG18463      CDS       T01060                                 

Definition
GG18463 gene product from transcript GG18463-RA
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dere_GG18463
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 824 aa AA seqDB search
MSEPELEQTPSVGHVEEQTAEEEHEPAQEPSDVYTIGGPPRTPVEDAAAELSASLDVSGS
DQSAEQSLDLSGVQAEPTAESEPPAKRQHRDISPISEDSTPASCTSTSSSWSSSSSGYAD
VKEAEEAPPEPEQPQQQQEEKEEGQEQVKSPVPVELQVQEQAQPQEQEAEMDQEIDTEDE
PSSNTVICVADINAYGSGSNIDDYVLDPDAPAKAIITEVVTIPAPLRLKGAQQLGLPLAN
PSPPPPPPAEDEVPETPASPTDDGEEPPAVGLSSYMRVRYMQDSTPGLPTRLAPRDPRQR
NMPPPAVLLPIQTVLTANVEAISDDSSETSSSEDDEEEEEDEDDALTMEHDSTSRETVIT
TGGDPMMQKIDISENPDKIYYIRREDGTVHRGQVLQSRTTENAATPNEYYVHYVGLNRRL
DGWVGRHRISDNADDLGGITVLPAPPLAPDQPSTSREMLAQQAAAAAAASSERQKRAGNK
DYYLSYCENNRYDYSDRKMTRYQKRRYDEINHVQKSHAELTATQAALEKEHESITKIKYI
DKLQFGNYEIDTWYFSPFPEEYGKARTLYVCEYCLKYMRFRESYAYHLHECDRRRPPGRE
IYRKGNISIYEVNGKEESLYCQLLCLMAKLFLDHKVLYFDMDPFFFYILCETDKEGSHIV
GYFSKEKKSLENYNVACILVLPPHQRKGFGKLLIAFSYELSRKEGVIGSPEKPLSDLGRL
SYRSYWAYTLLELMKNRCAPEQITIKELSEMSGITHDDIIYTLQSMKMIKYWKGQNVICV
TAKTIHDHLQLPQFKQPKLTIDTDYLVWSPHSAAAVAKAPGISG
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaccggagctggaacagacgcccagcgtgggccacgtggaggagcaaacggcg
gaggaggagcacgagccggcacaggagccatccgatgtgtacacaattggcggtccgccg
aggacgccggttgaagatgcagcggccgaattgagcgccagtctggacgtcagcggctcg
gatcagtcggcggagcagtcgctggacctcagcggtgtccaagcggagcccactgcggag
tcggagccaccggcgaagcgccagcatcgcgatatcagtcccatttcggaggacagtacg
ccagcgagctgcacatcgaccagttccagctggtcgtccagctcctcaggctacgccgat
gtcaaggaggcagaggaggcacccccagagccggagcaaccacagcagcagcaggaggag
aaggaggagggtcaggagcaggtgaaatcaccagttccagttgaattgcaggtacaggaa
caagcgcagccgcaagagcaggaagctgaaatggaccaggaaattgacaccgaggatgag
ccctcctccaatacggtgatttgcgttgccgacatcaacgcctatggcagtggctccaac
atagacgactacgttttggatcctgatgcgccggccaaggccatcattaccgaggtggtc
accattccagctcctcttcgtcttaaaggggcacaacaactggggctgccactggctaac
ccatcgccaccaccacctccgccagcagaggatgaagtccccgagactccagcctcgccc
acagatgacggcgaggaaccaccagcagtgggcttatccagctacatgcgtgttcgctac
atgcaggattcgacacctgggcttcccacccgactggcgcctcgtgatcctcgccagcgc
aacatgccgccgccagccgtattactgcccattcaaaccgtactcaccgccaacgtggag
gccatttctgacgacagcagtgaaacgagcagcagcgaagacgacgaagaggaagaggag
gacgaagacgatgccttgaccatggagcacgatagcacttccagggagacggtcatcaca
actggcggcgacccaatgatgcaaaagatcgatataagcgaaaatcccgacaagatctac
tacattcggcgcgaggatggcaccgtgcaccgtggccaggtgcttcagtcccggaccact
gagaatgcggctacgcccaatgagtactatgtccattatgtgggcctcaatcgccgcctg
gatggctgggtgggccgacaccggatctcggacaatgcggatgacttgggtggcattacc
gtgctgccagcgccaccattggcccccgatcagcccagcactagcagggaaatgcttgcc
caacaagccgccgcggcggcagctgcctcatccgagcggcagaagcgggcgggcaacaag
gactactatctgtcctattgcgagaacaatcgctatgactacagtgaccgcaagatgaca
cgctaccagaagcggcgctacgatgagatcaaccacgtgcagaagagccatgctgagctg
accgccacgcaggcggcgctggagaaggagcacgagtccattaccaaaatcaagtacatt
gataagctgcagtttggcaactacgagatcgacacctggtacttcagtccctttcccgag
gaatatggcaaggcacgaacgctgtatgtttgcgagtactgcctaaagtacatgcgcttc
agggagagctatgcctatcacctgcacgaatgcgaccgacggcgtccgcccggaagagag
atctatcgcaagggcaatatatccatttacgaggtaaacggcaaggaggagtcgctttac
tgtcagcttctgtgcctaatggccaagcttttcctcgaccacaaggttctgtacttcgac
atggacccattcttcttttacatcctgtgcgagacagacaaggagggcagccacattgtg
ggctacttctccaaggaaaagaagtcgctggagaactataatgtggcttgcattctggta
ttgccgccgcatcagcgcaagggatttggaaagctgctaattgcctttagctatgagctg
tcgcgcaaggagggtgtcatcggtagtccggagaagccgctctcggatctgggcagactg
agctatcgaagctattgggcatacacgctgcttgagctgatgaaaaaccgctgcgctcca
gagcagatcaccatcaaggagctgagcgaaatgagtggcattacccacgacgatattatc
tacacgttgcagtccatgaagatgatcaagtactggaagggacagaatgtcatttgcgtt
acggccaagaccattcatgaccatctacagctgccgcagttcaagcagcccaagctgacc
atcgacaccgattacctcgtctggagtccgcacagtgcagcggcagtggccaaagctccg
ggaatttccggctag

DBGET integrated database retrieval system