KEGG   Drosophila erecta: Dere_GG18531Help
Entry
Dere_GG18531      CDS       T01060                                 

Definition
GG18531 gene product from transcript GG18531-RA
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dere_GG18531
Protein kinases [BR:der01001]
 Serine/threonine protein kinases: Other group
  Aur family [Table]
   Dere_GG18531
Protein phosphatases and associated proteins [BR:der01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dere_GG18531
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 421 aa AA seqDB search
MSHPSDHVLRPKENAPVRLPEKSAAVHNMQKNLLLGKMPNSENVAPSNKPLPGSTGAVIR
SAATTVRPATKPVPGASNPIGSSEGSNFQKPLVPSVKKATSEFVAPAPVAPIKKPESLSK
LKTAVAGSESSKEPGAASSTTDKEKTKTETQPQKPKKTWELNNFDIGRLLGRGKFGNVYL
AREKESQFVVALKVLFKRQIGESNVEHQVRREIEIQSHLRHPHILRLYAYFHDDVRIYLI
LEYAPQGTLFNALQAQPMKRFDERQSATYIQALCSALLYLHERDIIHRDIKPENLLLGHK
GVLKIADFGWSVHEPNSMRMTLCGTVDYLPPEMVQGKPHTKNVDLWSLGVLCFELLVGHA
PFYSKNYDETYKKILKVDYKLPEHISKAASHLISKLLVLNPQHRLPLDQVMVHPWILAHT
Q
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgtcccatccgtctgaccatgtgctgcgccccaaggaaaatgctccggtcagactgccg
gaaaaatccgctgccgtgcataatatgcagaagaacttgctattgggaaagatgcccaac
agcgagaacgtggccccatccaacaaacccttgccaggatctactggcgctgtgattagg
agtgcggcgaccaccgtgcgtccagccactaagccagtgccaggagcctccaatcccata
ggttcctccgaaggaagcaacttccagaaacccctggtgccgtccgtgaaaaaggccaca
tcagagtttgttgctccagctccagtagcacccatcaagaagcccgaatccctttccaag
ctgaaaaccgctgttgcgggctcagaatcctcaaaggaacctggtgcggccagcagcacc
acagacaaagagaaaaccaagactgaaacacagccacagaagcccaagaagacatgggag
cttaacaactttgatattggtcgcctgctggggcgcggcaagtttggcaacgtttacttg
gcgcgcgaaaaggaatcgcagtttgtggtggcccttaaagtgctgttcaagcgtcagatt
ggcgagtccaatgtggagcaccaggtgcgccgggagatcgagatacaatcgcacctgcgt
catccgcatatcctacgtctgtacgcctactttcacgacgacgtgcgcatatatctgatc
ttggagtatgccccacaaggaacgctctttaatgccttgcaggcacagccgatgaagcgt
ttcgatgagcgccagtcggcaacctatattcaggcgttgtgctcggcgctgctctatctg
catgagcgggacatcatccacagggatattaagccggagaacttgctgctgggccacaag
ggcgtcctgaagatcgccgactttggctggtccgtgcacgagccaaattccatgcgcatg
acactgtgcggcactgtcgactatttgccacccgaaatggtgcagggcaagccgcacacg
aaaaacgtcgatctttggagcctgggtgtgctctgctttgagctgttggtgggccacgct
cccttctactcgaagaactacgacgagacctacaagaagatactcaaggtggactacaaa
ttgccggagcacatttccaaggcggcttcacatctcatttccaagctgctggtccttaat
ccgcagcaccgcctaccgctggatcaggtgatggtgcacccttggatcctggcgcacacg
cagtga

DBGET integrated database retrieval system