KEGG   Drosophila erecta: Dere_GG18559Help
Entry
Dere_GG18559      CDS       T01060                                 

Gene name
Dere_EG:EG0007.7
Definition
GG18559 gene product from transcript GG18559-RA
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
der  Drosophila erecta
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 542 aa AA seqDB search
MKINHKYEFDDDVASICESTAALTEGCRLPVRMHKTDDWPLAEIVSIKELDGRRQFYVHY
VDFNKRLDEWVNEEDLYTRKVQFPRRDGSQTGTSTGVTTPQRHHSLAGSVSRPTSPQHPG
SGVLTAIASTPTGASGSVPPLAGIPSSVAPPGTPSSVGELVNGNNLAAALQKRINRKRKV
HGGSAHGHHSLSSQQQQSHPHPTTPQTPTTTPVHVTGDGLISGAANEDGDGSQDGKTPTP
RQSGSMVTHQDDVVTRMKNVEMIELGRHRIKPWYFSPYPQELCQMPCIYICEFCLKYRKS
RKCLERHLSKCNLRHPPGNEIYRKHTISFFEIDGRKNKVYAQNLCLLAKLFLDHKTLYYD
TDPFLFYVMTEFDSRGFHIVGYFSKEKESTEDYNVACILTMPPYQRKGYGKLLIEFSYEL
SKFEGKTGSPEKPLSDLGLLSYRSYWAQTILEIFISQNPSTDGEKPTITINDICECTSIK
KEDVISTLQNLNLINYYKGQYIVCINRDTIEQHRRAMDKRKIRIDSKCLHWTPKDWSKRS
KW
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaccacaaatatgagttcgacgacgatgtggcctccatttgcgagtcaacg
gccgcccttaccgagggatgtcgtttgcccgtcaggatgcacaaaacggacgactggccg
ctggcggagattgtgagcatcaaagagctggatgggcgccggcagttttatgtgcactat
gtggacttcaacaagcgcttggacgaatgggtcaacgaggaggatctgtatacgcgaaag
gtgcaatttccgcggcgggacggttcccaaacaggaaccagcaccggagtgaccacaccc
cagcgccaccattccctggcgggcagcgtttctcggcctacatcgccgcaacatcctggt
tccggtgttctgacagccatcgcctcgactcccactggtgcatcaggcagtgttcctccc
cttgcaggcattcccagctctgtggctcctcccggaacacccagcagtgtgggagagctt
gtgaatggcaataatttggctgcagcccttcagaagcgcattaatcgcaaacgaaaagtc
cacggaggctcggcccatggacaccacagcctatcgagtcaacagcagcagtcacatccg
catcctaccactccacagacacccacgactacgcccgtgcatgtgaccggcgatggtttg
ataagcggcgcggccaatgaggatggtgatggatcgcaagatggtaagacgcccacgcca
aggcaatcaggcagtatggttacgcaccaggacgacgtggtaacccgcatgaagaacgtg
gagatgattgagctgggtagacatcgcattaagccctggtatttctcgccctatccgcaa
gagctgtgccaaatgccctgcatctacatttgcgagttctgcctgaagtacaggaagagc
aggaaatgcctggagaggcacctctccaagtgcaatcttaggcatcctccggggaacgag
atctaccgcaaacacacaatatctttctttgaaatcgacggccgcaaaaataaggtgtat
gcccagaacttgtgcctgcttgccaaactctttctcgaccacaagacactttactatgat
acagatccgtttctcttctacgtaatgaccgagttcgactcgcgcggcttccacatagta
gggtacttctccaaggaaaaggaaagtaccgaggactacaacgtagcctgcattcttaca
atgcctccatatcagcgcaagggctacggcaagctgctcattgagttcagctacgagttg
tccaagtttgagggtaaaacgggatcgccggagaaaccattgtctgatctgggtttgctt
tcgtatcgatcgtactgggcgcaaaccatactggagatatttatcagtcaaaacccgagc
acggacggcgagaagcccacaataacaataaacgacatctgtgaatgcacatccatcaaa
aaagaggacgtgatctcaacgctgcaaaacctgaacctgatcaactactacaagggccag
tacatcgtgtgcatcaaccgggataccatcgagcagcaccgtcgcgcaatggacaaacgc
aagatccgcattgactcaaaatgcctacactggactccaaaagactggtccaagcgctct
aaatggtaa

DBGET integrated database retrieval system