KEGG   Drosophila erecta: Dere_GG18759Help
Entry
Dere_GG18759      CDS       T01060                                 

Definition
(RefSeq) GG18759 gene product from transcript GG18759-RB
  KO
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dere_GG18759
Peptidases [BR:der01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dere_GG18759
Ubiquitin system [BR:der04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dere_GG18759
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 1112 aa AA seqDB search
MVKKRQADNHDHESSTDSGDEELHHRNALGSAGQVDGATPTTASCQHIKKAVDATRLRRL
LKSTGLLYECSQCQKLGKTVGTSGAGAGEGTVGSGGDPGDFEFDSTLWLCLKCGTQLCGR
ARHKHALEHYQTPHSDSHALAMNTRSFDIWCYECDMKICSNLRKNLLECVELVKKLAQKP
PTATVTPSPPTISYIEQRIKATLEHLTPIVPMTGGSFDDTGGGGALAVGAGGGSRSSQVA
IPMPPPPPSSGHSPSDSLTSVPGMAKRIGQYFSTTNGNTGDSRVLTLETPRIEMDRLPRV
RGLTNLGNTCFFNAVMQCLAQTPFLLSVLRELAEPGEEFVLPGGTFNIKDKGDIELPMIK
GTLSSWGGLTAALANALEELQAGGCVFTPSKLFDRLCIKCPQFTGGDQHDAHELLRQLLE
SVRNEDLKRYQRVILQNLGYKDQDVNSVSEEMRQKCKIYGNQAGDRILRPEQVFRGFLVS
TLTCQDCHSVSSRHEYFLDMSLPVAVEKPQPPQRRKPSPELNPATSSSSGTQTSSQPTIN
TKFTDGSVNFTVSISFFLHDGEEGSLGPSKSQVKKEKERERKAKRAAKHQRHKQTQKLSL
KLNGNDCGNDCAESGEQSAAPLASLGAGDGQANDGPEQPKVQTEESTSSSVTTSEHSDAD
VEDNLVEDSAPPSATTVSSSSASSTAPSKLYTDSNGNAQQLGEKRDDTPEHMDKDSLEED
ENDSGIATSPAPTATNSSTSTNATGNNNSGSGSGALEAASTPASLVSAGLSEKGASLIRQ
ISVGAEQGAPNGTAGANGEAKANTQPAKTTNQAQSQAQALAKAQARAKRVRTQSYSDWST
TIAPRYQCEDGECSVQSCLNNFTAVELMTGQNKVGCESCTQRINGSDPKAKSVNTNATKQ
LLVSSPPAVLILHLKRFQLGPRCIFRKLTRPVSYPNLLDIAAFCGSKVKNLPNIDRKQKK
LLYALYGVVEHSGGMYGGHYTAYVKVRPKVTPDDKRWKFLPHGSKAELDQDDDQLKKLEE
LLAKEKARELHLKAMDDSDDFSNSSSNSYTSDEGHAPTTPPEEQQPQQQEEAANVHAPPG
KWYYVSDSRVQEVSEDTALKAQAYLLFYERIY
NT seq 3339 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaaagcgtcaggcggacaatcacgaccacgaaagctcaacggattccggcgat
gaggagctgcaccatcggaacgcacttggttccgccggccaggttgatggcgccacgccc
accaccgccagctgccagcacattaagaaggcggtggacgcgacccggctgaggcgtcta
ctaaagtccacgggtctgctctatgagtgcagtcagtgccagaagctgggcaagaccgtg
ggcaccagcggtgcgggagcgggagaaggaactgtcggctctggcggagatcccggcgac
tttgagttcgacagcaccctttggctgtgcctcaagtgcggcacccagctgtgcggaagg
gctcgtcacaagcacgccttagaacattaccagacacctcattcggactcgcatgcccta
gccatgaacacgcgctcttttgacatttggtgttatgaatgcgacatgaagatctgctcc
aatctgcgcaagaatctgctggagtgcgtggagctggtcaagaagttggcccagaagccg
cccaccgccacggttacgcccagtccgcccacgattagctacatcgagcagaggattaag
gccacgctggagcacctcacaccgatcgtgccaatgactggcggatcatttgacgacacc
ggcggaggaggggctctggcggtgggcgcgggcggaggatcgcgaagcagccaggtggcc
ataccgatgccaccaccgccgcccagttccggacattcgccatcagattcgctgacaagt
gtgccgggtatggcaaagagaattggtcagtacttctccaccaccaatggcaacactggg
gacagccgagtcctgaccctggagacgccgcgtatcgaaatggaccgtctgccccgcgtg
cgaggcttgaccaacctgggcaatacttgcttctttaatgcggtgatgcagtgcctcgcc
cagacgccgttcctacttagcgtgcttagagagctggcggagcccggagaagaatttgtc
ctacctggaggaacattcaacataaaggacaaaggagacattgagctgcccatgatcaag
ggtaccctctcctcttggggcggactcaccgccgcgttagccaatgcccttgaggaactg
caggctggcggttgtgtatttacgcccagcaagctcttcgacaggctgtgcataaaatgt
ccacagtttacgggcggtgatcagcatgatgctcacgaactactccgccagctgctggag
agcgtgcggaacgaggatcttaagcgctaccagcgtgtgattttgcagaacctcggctac
aaggatcaagatgtcaatagtgtgtcagaggagatgcgacagaagtgcaagatctacggc
aaccaagcaggagaccgcatcctgcgcccggagcaggtattccgtggcttcctagtgtcg
acgctcacctgccaggactgccacagcgtgtcctcgcgccacgagtacttcctggacatg
tcactgcccgtggccgtagagaagcctcagccgccgcagcgccgaaagccgagtccggag
ctcaatccagcgaccagcagctccagcggcacccagacctccagtcagccgacgataaac
accaagtttacggatggtagcgttaactttacagtctccatatccttcttcctgcacgac
ggtgaggagggatccctgggcccgtccaagtcgcaggtgaaaaaggaaaaggaacgcgag
cgtaaggcaaaacgggcagccaagcaccagcgccacaagcaaacccagaagttgagtctt
aagctaaacgggaatgactgcggaaatgattgcgccgagtccggagaacagagcgctgct
ccattggcgtccctgggtgccggcgatggccaggctaacgatggccccgaacaacccaag
gtccagaccgaggaatccacctcctccagcgtgactacttcggagcactctgacgctgat
gtcgaggacaatctggtggaggactcagccccgccgtccgctactactgtgtccagcagt
tcggcatcctcgacagctccctccaagttatacacggacagcaatggcaatgcccagcag
ctgggcgagaagcgcgacgacacgccggagcacatggacaaggattcgctcgaagaagat
gagaatgactcgggaatcgccaccagtccagcaccaactgctaccaatagcagcaccagc
accaatgccaccggaaacaacaactcgggttccggatctggtgctctcgaggctgcctcc
acgccagcgagcctggtcagtgccggactctcagagaagggcgcctcgctgatccgccag
atctcagtgggcgctgagcagggtgcccccaatggcactgcaggcgcgaatggagaagcc
aaggcgaacacgcagccagcgaagactactaatcaggcccagagtcaggcccaagccttg
gctaaagcccaggcccgtgcgaagcgagtgcgcacgcagagctactcggactggagcacc
acgatagcgccacgctaccaatgcgaggatggagagtgctccgtgcagtcgtgcctgaac
aatttcaccgctgtcgagctgatgacgggacagaacaaggtgggatgcgaaagctgcacc
caacgcatcaatggcagcgatccgaaggctaagtcggtgaacaccaatgccacgaagcag
ctgctggtctccagtccgccagcggtgctcatactgcacctgaagcgtttccagctggga
ccgcgctgcatctttcgcaagctgacgcgcccggtcagctatccaaatttgctggacatt
gccgccttctgtggctccaaggtaaagaatctgccaaacatcgatcgcaagcagaagaag
ctgttgtacgccctatacggcgtggtggagcactcgggcggcatgtacggtggccactac
acggcgtacgtgaaggtgcgtcccaaggtgacgccggacgataaacgctggaagtttctg
ccgcacggcagcaaggcggaactggaccaggacgatgatcagctaaagaaattggaggag
ctgcttgccaaggagaaggcgcgcgagctgcatctgaaggcgatggacgacagcgatgac
ttcagcaattccagcagcaactcgtacacctccgacgagggccatgccccaaccacgccg
cccgaggagcagcagccgcagcagcaggaggaggccgccaatgtgcatgcgccgcctggc
aaatggtattacgtgtccgactcgcgtgtccaggaggtcagcgaggatacggccctaaag
gcgcaggcctatctgctcttctacgagcgcatatactaa

DBGET integrated database retrieval system