KEGG   Drosophila erecta: Dere_GG18759Help
Entry
Dere_GG18759      CDS       T01060                                 

Definition
GG18759 gene product from transcript GG18759-RA
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
der  Drosophila erecta
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1127 aa AA seqDB search
MERVHKEAKAKKVLDMVKKRQADNHDHESSTDSGDEELHHRNALGSAGQVDGATPTTASC
QHIKKAVDATRLRRLLKSTGLLYECSQCQKLGKTVGTSGAGAGEGTVGSGGDPGDFEFDS
TLWLCLKCGTQLCGRARHKHALEHYQTPHSDSHALAMNTRSFDIWCYECDMKICSNLRKN
LLECVELVKKLAQKPPTATVTPSPPTISYIEQRIKATLEHLTPIVPMTGGSFDDTGGGGA
LAVGAGGGSRSSQVAIPMPPPPPSSGHSPSDSLTSVPGMAKRIGQYFSTTNGNTGDSRVL
TLETPRIEMDRLPRVRGLTNLGNTCFFNAVMQCLAQTPFLLSVLRELAEPGEEFVLPGGT
FNIKDKGDIELPMIKGTLSSWGGLTAALANALEELQAGGCVFTPSKLFDRLCIKCPQFTG
GDQHDAHELLRQLLESVRNEDLKRYQRVILQNLGYKDQDVNSVSEEMRQKCKIYGNQAGD
RILRPEQVFRGFLVSTLTCQDCHSVSSRHEYFLDMSLPVAVEKPQPPQRRKPSPELNPAT
SSSSGTQTSSQPTINTKFTDGSVNFTVSISFFLHDGEEGSLGPSKSQVKKEKERERKAKR
AAKHQRHKQTQKLSLKLNGNDCGNDCAESGEQSAAPLASLGAGDGQANDGPEQPKVQTEE
STSSSVTTSEHSDADVEDNLVEDSAPPSATTVSSSSASSTAPSKLYTDSNGNAQQLGEKR
DDTPEHMDKDSLEEDENDSGIATSPAPTATNSSTSTNATGNNNSGSGSGALEAASTPASL
VSAGLSEKGASLIRQISVGAEQGAPNGTAGANGEAKANTQPAKTTNQAQSQAQALAKAQA
RAKRVRTQSYSDWSTTIAPRYQCEDGECSVQSCLNNFTAVELMTGQNKVGCESCTQRING
SDPKAKSVNTNATKQLLVSSPPAVLILHLKRFQLGPRCIFRKLTRPVSYPNLLDIAAFCG
SKVKNLPNIDRKQKKLLYALYGVVEHSGGMYGGHYTAYVKVRPKVTPDDKRWKFLPHGSK
AELDQDDDQLKKLEELLAKEKARELHLKAMDDSDDFSNSSSNSYTSDEGHAPTTPPEEQQ
PQQQEEAANVHAPPGKWYYVSDSRVQEVSEDTALKAQAYLLFYERIY
NT seq 3384 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgtccacaaggaggccaaggccaagaaggtgctcgacatggtaaaaaagcgt
caggcggacaatcacgaccacgaaagctcaacggattccggcgatgaggagctgcaccat
cggaacgcacttggttccgccggccaggttgatggcgccacgcccaccaccgccagctgc
cagcacattaagaaggcggtggacgcgacccggctgaggcgtctactaaagtccacgggt
ctgctctatgagtgcagtcagtgccagaagctgggcaagaccgtgggcaccagcggtgcg
ggagcgggagaaggaactgtcggctctggcggagatcccggcgactttgagttcgacagc
accctttggctgtgcctcaagtgcggcacccagctgtgcggaagggctcgtcacaagcac
gccttagaacattaccagacacctcattcggactcgcatgccctagccatgaacacgcgc
tcttttgacatttggtgttatgaatgcgacatgaagatctgctccaatctgcgcaagaat
ctgctggagtgcgtggagctggtcaagaagttggcccagaagccgcccaccgccacggtt
acgcccagtccgcccacgattagctacatcgagcagaggattaaggccacgctggagcac
ctcacaccgatcgtgccaatgactggcggatcatttgacgacaccggcggaggaggggct
ctggcggtgggcgcgggcggaggatcgcgaagcagccaggtggccataccgatgccacca
ccgccgcccagttccggacattcgccatcagattcgctgacaagtgtgccgggtatggca
aagagaattggtcagtacttctccaccaccaatggcaacactggggacagccgagtcctg
accctggagacgccgcgtatcgaaatggaccgtctgccccgcgtgcgaggcttgaccaac
ctgggcaatacttgcttctttaatgcggtgatgcagtgcctcgcccagacgccgttccta
cttagcgtgcttagagagctggcggagcccggagaagaatttgtcctacctggaggaaca
ttcaacataaaggacaaaggagacattgagctgcccatgatcaagggtaccctctcctct
tggggcggactcaccgccgcgttagccaatgcccttgaggaactgcaggctggcggttgt
gtatttacgcccagcaagctcttcgacaggctgtgcataaaatgtccacagtttacgggc
ggtgatcagcatgatgctcacgaactactccgccagctgctggagagcgtgcggaacgag
gatcttaagcgctaccagcgtgtgattttgcagaacctcggctacaaggatcaagatgtc
aatagtgtgtcagaggagatgcgacagaagtgcaagatctacggcaaccaagcaggagac
cgcatcctgcgcccggagcaggtattccgtggcttcctagtgtcgacgctcacctgccag
gactgccacagcgtgtcctcgcgccacgagtacttcctggacatgtcactgcccgtggcc
gtagagaagcctcagccgccgcagcgccgaaagccgagtccggagctcaatccagcgacc
agcagctccagcggcacccagacctccagtcagccgacgataaacaccaagtttacggat
ggtagcgttaactttacagtctccatatccttcttcctgcacgacggtgaggagggatcc
ctgggcccgtccaagtcgcaggtgaaaaaggaaaaggaacgcgagcgtaaggcaaaacgg
gcagccaagcaccagcgccacaagcaaacccagaagttgagtcttaagctaaacgggaat
gactgcggaaatgattgcgccgagtccggagaacagagcgctgctccattggcgtccctg
ggtgccggcgatggccaggctaacgatggccccgaacaacccaaggtccagaccgaggaa
tccacctcctccagcgtgactacttcggagcactctgacgctgatgtcgaggacaatctg
gtggaggactcagccccgccgtccgctactactgtgtccagcagttcggcatcctcgaca
gctccctccaagttatacacggacagcaatggcaatgcccagcagctgggcgagaagcgc
gacgacacgccggagcacatggacaaggattcgctcgaagaagatgagaatgactcggga
atcgccaccagtccagcaccaactgctaccaatagcagcaccagcaccaatgccaccgga
aacaacaactcgggttccggatctggtgctctcgaggctgcctccacgccagcgagcctg
gtcagtgccggactctcagagaagggcgcctcgctgatccgccagatctcagtgggcgct
gagcagggtgcccccaatggcactgcaggcgcgaatggagaagccaaggcgaacacgcag
ccagcgaagactactaatcaggcccagagtcaggcccaagccttggctaaagcccaggcc
cgtgcgaagcgagtgcgcacgcagagctactcggactggagcaccacgatagcgccacgc
taccaatgcgaggatggagagtgctccgtgcagtcgtgcctgaacaatttcaccgctgtc
gagctgatgacgggacagaacaaggtgggatgcgaaagctgcacccaacgcatcaatggc
agcgatccgaaggctaagtcggtgaacaccaatgccacgaagcagctgctggtctccagt
ccgccagcggtgctcatactgcacctgaagcgtttccagctgggaccgcgctgcatcttt
cgcaagctgacgcgcccggtcagctatccaaatttgctggacattgccgccttctgtggc
tccaaggtaaagaatctgccaaacatcgatcgcaagcagaagaagctgttgtacgcccta
tacggcgtggtggagcactcgggcggcatgtacggtggccactacacggcgtacgtgaag
gtgcgtcccaaggtgacgccggacgataaacgctggaagtttctgccgcacggcagcaag
gcggaactggaccaggacgatgatcagctaaagaaattggaggagctgcttgccaaggag
aaggcgcgcgagctgcatctgaaggcgatggacgacagcgatgacttcagcaattccagc
agcaactcgtacacctccgacgagggccatgccccaaccacgccgcccgaggagcagcag
ccgcagcagcaggaggaggccgccaatgtgcatgcgccgcctggcaaatggtattacgtg
tccgactcgcgtgtccaggaggtcagcgaggatacggccctaaaggcgcaggcctatctg
ctcttctacgagcgcatatactaa

DBGET integrated database retrieval system