KEGG   Drosophila erecta: Dere_GG18955Help
Entry
Dere_GG18955      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein
Organism
der  Drosophila erecta
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase
Motif
Other DBs
NCBI-GeneID: 6551567
NCBI-ProteinID: XP_001977288
FlyBase: FBgn0111161
UniProt: B3NT35
Position
Unknown
AA seq 417 aa AA seqDB search
MPGHVNHLLLLGCLLCLLGDVPSTEAFHRWSPMMKAFRYLQETMLRNSLERAHLNHGIVF
ECRTISAKDFGNEVHFNLQLGDLRGFRRLDPNKKLALFLHGWNDQGSKDWVQELLLTWTL
FDANYNVCVVDWGNLSQNDYKSASMSIFDVGLTVAGIIMALEELRPNHFHRSNVTLAGYS
LGAHAAGYAGAVLEGQVEQIIGLDPAGPLFSLPAEVAPKYRLDPGDAQFVQVLHTSGGSL
GTNLKCGHADFYPNGGRAPQPNCKMFANLRDMQNTNPVSCSHSAAAIFFRQSMDPEYPFV
GSECGSNREFSAGFCDGNRKARFGIHSQRRARGSFYFRTAPQPPYVQRRQADWLSGVGRM
AAAKVSPGAQSPLMLRLWTNSWRRERARERQRRDRDRDRERDREREVSLCASNLTSS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgcccggtcacgtgaaccacctgctgctccttggctgcctgctctgcctgctcggcgat
gtgccgagcaccgaggccttccaccgctggagtcccatgatgaaggccttccgctatctg
caggagaccatgctccggaacagcctggaacgtgcccacctcaatcacgggatcgtcttc
gagtgccgcaccatatcggccaaggatttcggcaatgaagtgcacttcaatctgcagctt
ggagaccttcgaggattccgccgcctggatcccaacaagaagctggctctatttctgcac
ggctggaatgatcagggcagcaaggattgggtgcaagaactattgctgacctggaccctc
ttcgacgccaactacaacgtgtgcgttgtggactggggaaacctgtcgcagaacgactac
aagtccgcctccatgtccatcttcgatgtgggtctgacggtggccggcatcatcatggcc
ctggaggagctgcgtcccaatcactttcaccgcagcaacgtgaccctggcgggctatagt
ttgggtgcccatgccgccggctatgcgggcgccgtgctggagggtcaggtggagcagatc
attgggctggatcccgccggaccgctgttctcgctgcccgccgaggtggcgcccaagtac
cgcttggatcccggcgatgcccagttcgtccaggtgctccacacctccggcggctccctg
ggcaccaatctcaagtgcggtcacgccgatttctatcccaatggcggtagggcgccgcag
ccgaactgcaagatgtttgccaatctgcgcgacatgcagaataccaatcccgtttcctgc
agccactcggcggctgccattttcttccgccagtcgatggatcccgagtacccgttcgtg
ggcagcgagtgcggcagcaaccgggagttctccgccggattttgcgatggcaaccggaag
gcgcgcttcgggatccattcgcagcggcgtgcgcgggggagcttctacttccgcaccgcc
ccccagccgccgtacgtgcagcggcggcaggccgactggctgagcggggtggggcgcatg
gcggcggccaaggtcagtccgggcgctcagagcccccttatgctgcgcctctggacgaac
agctggcggcgcgagcgagcgagagagcgacagcggagagacagagaccgagacagagag
agagacagagagagagaggtatcgctgtgcgcgagtaacttaactagttcctag

DBGET integrated database retrieval system