KEGG   Drosophila erecta: Dere_GG18963Help
Entry
Dere_GG18963      CDS       T01060                                 

Definition
GG18963 gene product from transcript GG18963-RA
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
der  Drosophila erecta
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:der00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dere_GG18963
   04330 Notch signaling pathway
    Dere_GG18963
   04350 TGF-beta signaling pathway
    Dere_GG18963
   04630 Jak-STAT signaling pathway
    Dere_GG18963
   04068 FoxO signaling pathway
    Dere_GG18963
Enzymes [BR:der01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Dere_GG18963
Transcription factors [BR:der03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    Dere_GG18963
Mitochondrial biogenesis [BR:der03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    Dere_GG18963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 3296 aa AA seqDB search
MMADHLDEPPQKRVKMDPTDISYFLEENLPDELVSSSSGWSDQLTGGAGGGNGGGGASGV
TTNSTSGPNPGGGPNKPAAQGPGPGSGTGGVGVGVNVTVGGVVGVVPSQMNGAGGGNGSG
TGGDDGSGNGSGAGNRISQMQHHQQLQHLLQQQQQGQKGAMVVPGMQQLGSKSPNLQSPN
QGGMQQVVGTQMGMVNSMPMSISNNGNNGMNAIPGMNTIAQGNLGNMVLTNSVGGGMGGM
VNHLKQQPGGGGGGMINAVSVPGGPGSGAGGVGAGGGGAVTPNQGMHMQNGPMMGRMVGQ
QHMLRGPHLMGAAGGAGGPGNGPGGGGPRMQNPNMQMTQLNSLPYGVGQYGGPGGGNNPQ
QQQQQQQQLLAQQMAQRGGVVPGMPQGNRPVGTVVPMSTLGGDGSVPAGQLVSGNPQQQQ
MLAQQQTGAMGPRPPQPNQLLGHPGQQQQQQPGTSQQQQQGVGLGGAGVVANAGTVAGVP
TVAGGGAGGAVQASGPGGANRDVPDDRKRQIQQQLMLLLHAHKCNRRENLNPNREVCNVN
YCKAMKSVLAHMGTCKQSKDCTMQHCASSRQILLHYKTCTNSGCVICYPFRQNHSVFQNA
NVPPGGGPAGIGGAPPGGGGAAGGAAGAGGNLQQQQQQQQQQQQNQQPNLTGLVVDGNQG
QQVAPGGGQNTAIVLPQQQGAGGAPGAPKTPADMVQQLTQQQQQQQQVHQQQVQQQELRR
FDGMGQVGLSPVPAGGMQQQGLPPVIRMQGAQPAVRVLRPGRPGGQTGPNVLPNDVNSLH
QQQQQMLQQQQQGQNRRLGGLATMVEQQQQQQQQQQQPNPAQLGGNIPAPLSVNVGGFGN
TNFGGTAAGGAVGANDKQQLKVAQVHPQSHGVGAGGAAAGAGASGGQVAAGSSVLMPADT
TGSGNAGNPNQNAGGGAGGAGGGNSGNSGPSGDNEKDWRESVTADLRNHLVHKLVQAIFP
TSDPTTMQDKRMHNLVSYAEKVEKDMYEMAKSRSEYYHLLAEKIYKIQKELEEKRLKRKE
QHQQMLMQQQGVANPAAGGAAGGAGSAAGGAGGVVLPQQQQQQQQQQQQQGQQPLQSCIH
PSISPMGGVMPPQQLRPQGPPGILGQQAAAVLGVGVGVTNNMVTMRSHSPGGNMLALQQQ
QRMQFPQQQQQQPPGSGAGKMLVGPPGPSPGGMVVNPALSPYQTTNVLTSPVPGQQQQQQ
FINANGGTGANPQLSEIMKQRHIHQQQQQQVQQQQQQQQQQGMLLPQSPFSNATPLQQQQ
QQQQATSNSFSSPMQQQQQQQQQQQQQQQGQQQQQQKPGSVLNNMPPTPTSLEALNAGSG
APGTGGSASNVTVSAPSPSPGFLSNGPSIGTPSNNNNSSSANNNPPSVSSLMQQPLSNRP
GTPPYIPASPVPATSASGLAASSTPASAAATCASSGSGSNSSSGATAAGASSTSSSSSAG
SGTPLSSVSTPTSATMATSSSSGGGASGAGGGSSTTPASNPLHLMSGGTAGGGTGATTTT
STSLSSRMMSSSSSLSSQMAALEAAARDNDDETPSPSGENTNGSGGSGNAGGMASKGKLD
SIKQDDDIKKEFMDDSCGGNNDSSQMDCSTGGGKGKNVNNDGTSMIKMEIKTEEGLHGEV
KIKTEVMDVDEAGGSTAGEHHGEGGGGSGVGGGKDNINGAHDGGAGGGAVDIKPKTDTKP
LVPEPLAPNAGDKKKKCQFNPEELRTALLPTLEKLYRQEPESVPFRYPVDPQALGIPDYF
EIVKKPMDLGTIRTNIQNGKYSDPWEYVDDVWLMFDNAWLYNRKTSRVYRYCTKLSEVFE
AEIDPVMQALGYCCGRKYTFNPQVLCCYGKQLCTIPRDAKYYSYQNSLKEYGVASNRYTY
CQKCFNDIQGDTVTLGDDPLQSQTQIKKDQFKEMKNDHLELEPFVDCQECGRKQHQICVL
WLDSIWPGGFVCDNCLKKKNSKRKENKFNAKRLPTTKLGVYIETRVNNFLKKKEAGAGEV
HIRVVSSSDKCVEVKPGMRRRFVEQGEMMNEFPYRAKALFAFEEVDGIDVCFFGMHVQEY
GSECPAPNTRRVYIAYLDSVHFFRPRQYRTAVYHEILLGYMDYVKQLGYTMAHIWACPPS
EGDDYIFHCHPTDQKIPKPKRLQEWYKKMLDKGMIERIIQDYKDILKQAMEDKLGSAAEL
PYFEGDFWPNVLEESIKELDQEEEEKRKQAEAAEAAAAANLFSIEENEVSGDGKKKGQKK
AKKSNKSKAAQRKNSKKSNEHQSGNDLSAKIYATMEKHKEVFFVIRLHSAQSAASLAPIQ
DPDPLLTCDLMDGRDAFLTLARDKHFEFSSLRRAQFSTLSMLYELHNQGQDKFVYTCNHC
KTAVETRYHCTVCDDFDLCIVCKEKVGHQHKMEKLGFDIDDGSALADHKQANPQEARKQS
IQRCIQSLVHACQCRDANCRLPSCQKMKRVVQHTKNCKRKTNAGGCPICKQLIALCCYHA
KHCQEQKCPVPFCPNIKHKLKQQQSQQKFQQQQLLRRRVALMSRTAAPAALQGPAAVSGP
TVVSGGVPVVGMSGVAVSQQVIPGQAGILPPGAGGMSPSTAAVPSPVSGGAGAGGLAGMA
GMSGMTSPHPHQPGIGMKPGGGHSPSPNVLQVVKQVQEEAARQQVSHGGGFGKGVPMAPP
VMNRPMGGAGPNQNVVNQLGGMGVGVGGVGGVGVGGVGGVGVNQLNSSGGGNTPGGPIPG
SGMNHLMSMDQWGGGGAGGGGANPGGGNPQARYANNTGGMRQPAQMMQTNLIAPQQQQQM
MGGLGGPNQLGGGQMPVGGQHGGMGMGMGAPPMAGTVGGVRPTPGAGGGGGSATGGGLNT
QQLAQIMQKIKNNPTNESNQHILTILKQNPQIMAAIIKQRQQSHQQINAAAGGGAPGPGG
GALQQQQAGNGPQNPQQQQQQQQQQQQQQQVMQQQQLQHMMNQQQGGGGPQQMNPNQQQQ
QQVNLMQQQQQGGPGGPGSGLPTRMPNMPNTLGMLQSLPPNMSPGVSAQGGMVPNQNWNK
MRYMQMSQYPPPYPQRQRGPHMGGAGPGPGQQQFPGGGGGAGNFNAGGAGGAGGVVGVGG
VPGGAGSVPGGDQYSMANAAAASNMLQQQQGQVGVGVGVGVKPGPGQQQQQMGVGMPPGM
QQQQQQQQQQQQQQQQPLQQQQMMQVAMPNANAQNPSAVVGGPNAQVMGPPTPHSLQQQL
MQSARSSPPIRSPQPTPSPRSAPSPRAAPSASPRAQPSPHHVMSSHSPAPQGPPHDGMHN
HGMHHQSPLPGVPQDVGVGVGVGVGVGVNVGNVGVGNAGGALPDASDQLTKFVERL
NT seq 9891 nt NT seq  +upstreamnt  +downstreamnt
atgatggccgatcacttagacgaaccgccccaaaagcgggttaaaatggatccaacggac
atctcctactttctggaggagaacctgcccgatgagttggtgtcctcgagcagcggctgg
tcggatcagctgaccggcggagcaggcggtggcaatggaggtggcggcgcctccggtgta
accacaaactccacatccggcccaaatcccggtggtggacccaataaaccggcagcccaa
ggacccggtcccggctctggcactggcggagtcggtgttggagtcaatgtgaccgtcggc
ggtgttgtcggcgttgtgccttcccagatgaacggagccggcggcggcaacggatccggt
acgggtggtgacgacggcagtggcaacggctccggagcgggcaacaggatcagtcaaatg
cagcatcaccagcagctacagcacctactccagcagcagcaacagggccagaaaggtgcc
atggtggtgcctggcatgcagcagctgggcagcaagtcgcccaacctacagtcccccaac
cagggtggcatgcagcaggtggtgggcactcagatgggtatggtcaactcaatgcccatg
tcgatatcgaataatggcaacaatggcatgaacgccataccaggcatgaacaccattgcg
cagggcaatctgggaaacatggtgctgaccaacagcgttggcggcggcatgggcggcatg
gtcaatcatctcaagcagcagcctggcggcggcggcggtggcatgatcaatgccgtttcg
gtaccaggaggacctggatcaggagctggaggcgttggagctggcggcggaggagccgtt
accccgaaccagggcatgcatatgcagaacggcccgatgatgggacgcatggtggggcaa
cagcatatgcttcgtggcccccatctcatgggcgccgctggaggagctggtgggcctgga
aatggacctggtggcggcggaccacgcatgcagaatcccaacatgcaaatgactcaactc
aacagtctgccctacggagtgggtcagtatggtggaccaggcggtggcaacaacccccag
caacagcagcagcagcagcaacaactcctcgcccagcagatggcccaaagaggcggcgtc
gtaccgggcatgccgcagggcaatcgacccgtcggcacagtggtgcccatgtccacactc
ggcggcgatggttcagtgcccgcggggcagctggtcagcgggaatcctcagcagcaacag
atgctagcgcaacagcagaccggagccatgggcccacgtcctccgcaacccaaccagctg
ctcggtcaccccggacagcagcagcaacagcagcccggcacctcgcagcagcagcaacag
ggcgttggactcggaggagcaggcgttgtggccaatgcaggaaccgttgctggcgtgccg
acagtggcaggcggcggagccggtggcgccgtacaagccagcggccctggtggcgccaat
cgcgatgtgcccgacgaccgtaagcgacagatccagcagcaactgatgctcctcctccat
gcacacaagtgtaatcgcagggagaacctgaatccgaacagggaggtgtgcaacgtcaac
tactgcaaggcgatgaaatcagtgctggcccacatgggcacgtgcaaacagagcaaggac
tgcaccatgcagcattgtgcctcctcgcggcaaatcctcttgcattacaagacgtgcacg
aacagtggctgcgtaatttgctatcccttccggcagaatcattcggtttttcaaaatgcg
aatgtgccgccaggaggcgggccggctggaattggaggtgcgcctccaggtggcggcgga
gcggctggtggagcggctggagctggcggtaatcttcagcagcaacagcagcagcagcaa
caacagcagcagaaccagcagcccaacctgacgggtctggtggtggacggcaatcaagga
cagcaggttgcacctggaggtggccaaaacactgccatagttctgccccagcagcaggga
gcgggcggtgcaccgggtgcgccgaaaacgcctgcggacatggtgcaacaattgacccaa
cagcagcagcagcaacagcaggtgcaccagcagcaggttcaacagcaggaactccgtcga
ttcgatggcatgggccaagttggactctcgccggtgccagctggcggtatgcagcagcag
ggattgcctcctgtgattcgcatgcaaggcgctcagccggccgtcagggttctgagacca
ggtagacctggcggccaaactggacccaatgttctgccgaacgatgttaacagcctgcat
caacaacagcaacagatgctccagcagcagcagcagggccagaatcgacgactcggtggc
ctggcaaccatggtagagcaacaacaacagcagcagcagcaacagcaacaacccaatccc
gcccagctgggtggcaacattccagcaccactctctgttaacgtcggtggctttggcaat
accaatttcggtggtacagcagccggcggagccgtgggagccaacgacaagcagcagctg
aaggtggcccaagtgcatccgcagagccatggcgtcggagcgggcggagcagcagcgggc
gccggtgcgagtggtggccaagtggcagctggttccagtgtcctaatgccagccgatacc
acgggcagtggtaatgcaggcaatcccaaccagaatgctggcggtggagcaggaggtgcc
ggtggtggcaatagcggaaactccggtccttcgggcgacaacgagaaagactggcgggaa
tcggtgaccgccgatctgcgcaaccatctcgtccacaaactggtgcaggccatcttcccc
acctcggatcccacgaccatgcaggacaaacggatgcataatctcgtgtcctacgcggaa
aaggtcgagaaggacatgtacgaaatggccaagtccagatcggagtactatcacctgctg
gccgaaaagatctacaaaatccaaaaggagctggaggagaagcggctgaaacgtaaggag
cagcaccagcagatgctgatgcagcagcaaggcgttgcgaatccagcggctggaggagcg
gccggcggagcaggcagtgcagctggtggagcgggcggtgtagtcttgccccagcagcag
cagcagcaacaacaacagcagcagcagcagggtcagcagcccctgcagagctgtatccat
cccagcatcagtccaatgggcggtgtgatgcctccgcagcagctgcgtccgcagggacca
cctggaatactgggtcagcaggcggcagcagtcctgggcgtcggcgtgggagtcaccaac
aacatggtgaccatgcgcagtcattcgcccggtggcaacatgctcgccttgcagcaacaa
cagcgcatgcagttcccgcaacaacagcaacaacaaccgcccggatccggagccggcaaa
atgctggtcggcccaccaggacccagtcccggtggcatggtagtcaatcccgcgctttcg
ccttatcaaacgaccaatgtgctcaccagtccggtgcccgggcagcagcaacagcagcag
ttcatcaatgcgaacggcggcactggcgccaatcctcagctgagcgagatcatgaagcag
cgacacattcaccagcagcagcaacagcaggtgcagcagcaacaacagcagcagcagcag
cagggaatgctgttgccgcagtcgccattcagcaatgccacacctctacaacaacagcag
cagcagcagcaggcgactagcaacagctttagctcaccaatgcagcagcagcagcagcag
cagcaacagcaacagcagcagcagcaaggccagcaacagcaacaacagaagcccggcagt
gtgctgaacaatatgccgcccacgccgacgagtctggaagctctaaatgcggggtctgga
gcgccgggaacgggaggatccgcctccaatgtgacggtttcagctccgagcccatcgcct
ggcttcctgtccaacggcccgtcgattggcacgccctccaacaataataatagtagtagt
gctaacaacaacccgccctcggtgagcagtctaatgcaacaaccgctgagcaatcggccg
ggtacgcctccttatatacccgcctccccagtgccggcgacaagtgcctccggattggcg
gcgagcagtacgcccgcatcagcagcagccacctgtgcgagtagtggcagtggcagcaat
agcagcagtggagccactgcagcgggtgcaagttccacgtcatcatcatcctcggcgggc
tcgggtacgccactcagctcggtctcgactcctacttcggccacaatggccaccagcagc
agcagcggtggtggtgccagcggagcaggaggcggatcatccactacgcccgctagcaat
ccactgcacctcatgtctggaggaacggcaggaggcggaacgggagcgacgaccaccaca
tcgacctcattgagcagtcgcatgatgagcagctccagcagtctctcctcccagatggct
gccctggaggctgcggcgcgggacaacgacgatgagacaccatcgccgtccggtgagaat
acgaatggcagtggtggcagtggaaatgccggcggtatggcctccaagggcaagctggac
tccattaagcaggatgacgatatcaagaaggagtttatggacgacagctgtggcggtaac
aacgatagctcgcaaatggactgctcgacgggtggtggcaagggcaagaatgtgaacaac
gacggcaccagcatgatcaaaatggagatcaaaacggaggagggactccatggcgaggtg
aagatcaaaacggaagtcatggatgtggacgaggctggtggatcgacagccggagagcat
catggtgaaggcggcggcggcagtggtgttggtggcggcaaggacaacatcaatggtgcg
cacgatggcggcgcgggaggcggtgctgtggacataaagcccaagacggatacgaaacca
ctcgtaccggaaccactggcacccaatgcgggtgacaagaaaaagaagtgccaattcaat
cccgaagagctgcgcaccgctctgctgccgacgctggagaagctctacaggcaggagccc
gaatccgtgccctttcgctatccagttgatccccaggcgctgggcatacccgactacttt
gagatcgttaagaagcccatggatctgggcaccatacgcaccaacattcagaatggcaag
tacagtgatccctgggagtatgtggacgacgtttggctgatgttcgacaatgcctggctg
tacaatcgcaaaacatcgcgggtctatcgctactgcacaaagctttccgaagtttttgag
gcggagattgatccggtgatgcaggcactgggctattgttgcggcaggaagtacacattc
aatccacaggtgctctgctgctacggcaagcagctctgcacgattccgcgggatgcgaag
tactacagctaccagaacagtctaaaggaatacggtgtcgcctcaaatagatacacctac
tgccaaaagtgctttaacgacatccagggcgatacggtcacactgggcgacgatccactg
caatcgcaaacccaaatcaaaaaggatcagttcaaggagatgaagaacgatcacctcgag
ctggagccgtttgtcgattgccaggagtgcggacgcaaacagcaccagatctgcgtgctc
tggctggactccatctggcccggtggctttgtgtgcgacaactgcctgaagaagaagaac
tcgaagcggaaggagaacaagttcaatgccaaacgcctgcccaccaccaagctgggcgtg
tacatagagacgcgagtgaacaacttcctcaagaagaaggaggctggtgccggcgaggtg
cacattcgggtggtcagctcatcggacaagtgtgtggaggtgaagcccgggatgcggcga
cgattcgtggagcagggcgagatgatgaacgagtttccctaccgcgccaaagccctattc
gccttcgaggaggtggacggcatcgatgtgtgcttctttggcatgcacgtacaggagtat
ggatccgagtgcccggcgccgaatacgcgtcgtgtgtacatcgcctatttggattccgtt
catttcttccggccaagacagtaccgcacagcggtatatcacgaaatcctgctcggttac
atggactacgtgaaacagctgggctacacaatggcccatatctgggcctgtccgccctcg
gagggcgatgactacatcttccactgccatcccacggaccagaagattcccaagcccaag
cgcctgcaggagtggtacaaaaagatgctggacaagggcatgatcgagcgcatcatacag
gactacaaggatatcctcaagcaggcgatggaggacaaactgggctccgccgcagagctg
ccctactttgagggcgacttctggcccaatgtgctggaggagagcatcaaggaactggac
caggaggaggaggagaagcgcaagcaggccgaggccgcggaagcagcagctgcggcaaat
cttttctccatcgaggagaacgaggtcagcggcgatggcaaaaagaagggccaaaagaag
gccaagaagtcgaacaaatcgaaagcggcgcagcgtaagaacagcaaaaagtccaatgaa
catcaatcgggcaacgatctctccgccaagatatatgcgaccatggagaagcacaaggag
gtcttctttgtcatccgtctgcattcggcgcagtcggcagctagtttagcgcccatccag
gatcccgatccgctgctcacctgcgatctgatggacggacgcgatgccttcctgaccctc
gcccgcgacaagcactttgagttctcgtcactgcggcgcgcccagttctccaccctgtcc
atgttgtatgagctgcataaccagggccaggacaagttcgtttacacctgcaaccactgc
aagacggctgtggagacgcgctaccactgcaccgtttgcgatgacttcgatctgtgtatc
gtgtgcaaggagaaggttggccaccagcacaagatggagaagctcggcttcgacatcgac
gacggctctgcgctggcggatcacaagcaggcaaatccgcaggaggcccgcaagcagtcc
atccagcgatgcatccaatcgctggtgcacgcctgccagtgtcgcgatgccaactgccgt
ctgccatcgtgccagaagatgaagcgcgtcgtccagcatacgaagaactgcaagcgcaag
accaacgccggaggatgccccatttgcaagcagctcatcgccctctgttgctaccacgcc
aagcactgtcaggagcagaagtgccccgtgccgttctgtcccaacatcaagcacaagctc
aagcagcaacagtcccagcagaaattccagcagcagcagttgctgcgtcgtcgtgtggcg
ctcatgtcgcgtacagcagctccagcggcactgcaaggcccggctgcggtaagcggtccg
accgtcgtctctggcggagtgcccgtggtgggcatgtccggtgtggctgttagccaacag
gtgatccccggccaggcgggcatactgcctccgggagcgggtggcatgtcgccatctacc
gcggcagttccatcgcccgtttcaggaggagctggagccggtggattggctggaatggct
ggtatgagtggaatgacctcaccgcatccgcatcaaccaggaattggcatgaagccaggt
ggcggtcactcgccgtcgccaaatgtgctgcaagtggtgaagcaggtccaggaagaggca
gctcgtcagcaggtttcgcatggcggtggattcggcaagggtgtgcccatggcgccgccc
gtgatgaatcgtccaatgggaggcgcaggacccaaccaaaatgttgtcaatcaactcggc
ggcatgggcgttggagttggaggtgtcggcggtgttggcgtcggaggcgttggcggtgtg
ggtgttaatcaactcaattcgagtggcggtggcaatacaccaggtggccccattcctggc
tccggtatgaatcaccttatgtccatggatcagtggggcggtggcggagccggcggcggt
ggtgccaatcccggcggaggtaatccgcaagcgcgctatgccaacaatactggcggcatg
cgccagcccgcccagatgatgcaaacaaatctgatagcgccgcagcaacagcagcagatg
atgggcggactgggcggacccaaccaactgggaggtggacaaatgccagtcggcggacag
cacggcggaatgggaatgggcatgggagcgccgccaatggccggaactgttggcggagtg
cgtccaactcccggagcaggaggtggcggtggaagtgcgactggcggcggtctgaatacc
cagcaactcgcccagattatgcagaagatcaagaacaatcccaccaacgagagcaaccaa
cacatcctcaccatactgaaacagaatccgcagatcatggcggcaatcatcaagcagcgc
cagcagagccaccagcaaatcaatgcggcggcgggtggaggtgcacctggccccggtggt
ggagccttgcagcagcagcaggcgggcaacggacctcagaatccccagcagcagcagcag
caacaacagcagcagcagcagcagcaacaagtgatgcagcaacagcagttgcagcacatg
atgaaccagcagcagggcggcggcggtccacagcagatgaatcccaaccagcagcagcag
cagcaggtaaatctcatgcagcagcagcaacaaggtggacccggaggaccaggttctgga
cttcccacgcgcatgcccaacatgcccaataccttgggcatgctgcagagccttccgccc
aacatgtcgcccggcgtttccgctcagggaggaatggtgcccaaccagaactggaacaag
atgcgttacatgcagatgagccagtacccgccaccgtatccgcaacgccagcgtggtccg
cacatgggcggagcgggacccggtcccggccagcaacagttccccggtggcggaggtgga
gcgggcaacttcaatgcgggcggtgctggtggtgcaggaggcgttgtgggtgtgggcggc
gtgcccggaggagctggctcggtgcccggtggcgatcagtactcgatggcgaatgcggcg
gctgcatccaatatgctgcaacagcagcagggtcaggtgggcgtcggagtgggcgttggt
gtgaagccaggacccggccaacagcaacagcagatgggcgtgggcatgccgccgggtatg
cagcagcagcagcagcagcagcaacaacagcagcagcagcaacagcaaccgctgcagcag
cagcaaatgatgcaggtggcaatgccgaatgcgaatgcccagaatccgtcggcggtggtg
ggcggacccaatgctcaggtgatgggtccaccgacgccgcactccctgcagcagcagcta
atgcaatcggcccgctcatcgccgcccattcggtcgccacagccaacgccatcgccacgt
tcggctccatcgccacgtgctgctccctccgcctcgccaagggcacagccctcgccgcac
catgtgatgagcagccactcgccggcgccgcagggaccgccccatgacggtatgcacaat
catggcatgcatcatcagtcgccactgccaggagtgccgcaggatgttggcgtgggcgtt
ggtgtcggtgtcggcgttggtgttaatgtcggcaacgtgggcgtgggcaacgccggagga
gccctgcccgacgcctccgaccagctgaccaagttcgtggagagactctag

DBGET integrated database retrieval system