KEGG   Drosophila erecta: Dere_GG18969Help
Entry
Dere_GG18969      CDS       T01060                                 

Definition
GG18969 gene product from transcript GG18969-RA
Orthology
K13510  
lysophosphatidylcholine acyltransferase / lyso-PAF acetyltransferase [EC:2.3.1.23 2.3.1.67]
Organism
der  Drosophila erecta
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dere_GG18969
   00565 Ether lipid metabolism
    Dere_GG18969
Enzymes [BR:der01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.23  1-acylglycerophosphocholine O-acyltransferase
     Dere_GG18969
    2.3.1.67  1-alkylglycerophosphocholine O-acetyltransferase
     Dere_GG18969
Lipid biosynthesis proteins [BR:der01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   Dere_GG18969
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 474 aa AA seqDB search
MTTSTIKPTGGEEVPPAGVVGGVGDIAGVGVAASLTKRDSEEDTWASKGYNYINPFVHRI
EIDSHIEVAKIYVLTVLLLPIRVVGCVLSLISAWMFACIGLYGMTLDDLKAKPLTGWRKQ
VQCMTACGMRMVYTFGSFHYVTMKGRAATAKEAPILVVAPHSSYVDSILVVASGPPSIVA
KRETADIPLLGKIINYAQPIYVQREDPNSRQNTIRDIVDRARSADDWPQVVIFAEGTCTN
RTALIKFKPGAFYPGVPVQPVLLKYPNKYDTFTWTWDGPGVLRLLWLTMTQFYNRCEIEY
LPVYTPSEDEVADANLYANNVREVMAKALGVPTSDYSFEDVIVMSRARDMKIPFPGDIVE
IERTIEKLGLIESQRDAELCKGFLRLSNTDRLDIITFGELLQVDLKNTNLHKLFALLDHR
RAGTVSLKSFLLCSLFCKLKNSDLLTFLRALIHVIQSICCMKLCIYFNSFICNQ
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgtcgacaattaagccaacgggcggcgaggaagtgccgccggcgggagtggtg
ggcggtgtgggcgacatcgctggtgtgggagtggccgccagcctgacgaagcgggattct
gaggaggatacgtgggcatccaaggggtacaactacatcaatccgtttgtccatcgcatc
gaaatcgacagtcacattgaagtggccaagatctatgtgctgacagttctgctcctgccc
atccgcgtggtgggctgcgtcctctccctgatctccgcgtggatgttcgcctgcattgga
ctctatggaatgaccctggatgatctcaaggcgaaacccctcaccggctggcggaaacaa
gtgcaatgcatgacggcctgtgggatgcgcatggtgtacaccttcggatcgttccactat
gtgaccatgaagggacgagcggcgacggcgaaggaggcgcccattctggtggtggcaccg
cactcctcctacgtggactccatcctggtcgtggccagtggcccgccctcgatagtggcc
aagcgggagacggcggacataccgttgctcggaaagatcatcaactatgcccagcccatc
tatgtgcagcgcgaggatcccaattcccgccagaacaccatccgtgacattgtcgaccga
gcccgttccgcagacgactggccgcaggtggtcatctttgccgagggcacctgcaccaat
cgcacggctctgattaaattcaaaccgggcgcattctatccgggcgtgcccgtccaaccg
gtgctccttaagtacccgaataaatatgacaccttcacatggacctgggacggacctgga
gtattacgccttctctggctgacgatgacgcagttctataaccgctgcgagatcgaatat
ctgcccgtgtacacaccatcggaggacgaagtggccgatgccaatctgtatgccaacaat
gtgcgcgaggtgatggccaaggccttgggagtgcccacctcggattattcgtttgaggat
gtgattgtaatgagcagagctcgcgacatgaagattcccttccccggcgacatcgtggag
atcgagcgcaccatcgagaagctgggcctgatcgagagccaacgggacgcggagctgtgc
aagggcttcctgcggctgtccaacacggatcggttggatatcatcacgttcggcgagctg
ctccaggtggatcttaagaacactaatctccacaagctgtttgctctgctcgatcaccgt
cgcgccggcactgtgagtttgaagagcttcctgctctgttccctcttctgcaaattaaag
aattccgatctcttgaccttcctgcgtgccctcatccacgtaatacaatctatatgttgt
atgaaactatgcatttactttaattcgtttatttgcaaccaatag

DBGET integrated database retrieval system