KEGG   Drosophila erecta: Dere_GG18986Help
Entry
Dere_GG18986      CDS       T01060                                 

Definition
(RefSeq) GG18986 gene product from transcript GG18986-RB
  KO
K19603  
mitogen-activated protein kinase 15 [EC:2.7.11.24]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Dere_GG18986
Protein kinases [BR:der01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Dere_GG18986
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 460 aa AA seqDB search
MSKPNNVPAHERRIHELDQTVERIFDVRKRLGKGAYGIVWKAIDRRQKSTVALKKIFDAF
RDDTDAQRTYREVIFLRAFRHHPNIIRLVDVFKAANNLDFYLVFEFMESDLHNVIKKGDV
LKDIHKRFVMYQLINAIKYMHSGNVIHRDLKPSNILIDSKCRLKVADFGLARTLSSKRKA
DFDELDQDGMLTDYVATRWYRAPEILVASRSYTKGIDMWGLGCILGEMIRQKPLFQGTST
VNQIEKIVTALPDVTQLDIDSIGASFGTVLLGKKIHRDRRHSLDEMMRNCCDDAISLVKS
LLVLNPHLRLTAKAAIQHPYVSRFRTASADMELRVDIQPPLRDDVRYGVDQYRNNLYDMI
GRESRGSARTASNATPSTPSNRDESAKTVRVTTRARLRRPXQRRATSTVTSTSNLRQLDT
SKEREDSVESSTVQRPLKERLHRSRQRKAHPMRLNQGQSQ
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaccaaataatgttcccgctcacgagcgacgcatccatgagctggatcaaact
gtggaacgcatcttcgatgtgcgaaagcgcttgggtaagggtgcctatggcatcgtttgg
aaggccattgataggcgacagaagagcacggtggccctgaagaagatcttcgatgccttc
cgcgatgacaccgatgcccagcgcacctaccgtgaggtgatattcctgcgcgcctttcgc
caccatcccaacatcatacgactggtggacgtcttcaaggccgccaacaatttggatttt
tatttggtgtttgagttcatggaaagcgatctgcacaacgtgattaagaagggcgatgtc
ctcaaggacattcacaagcgattcgtcatgtaccagctgatcaatgccatcaagtacatg
cactcgggcaacgtcatccacagggacctgaagcccagcaacatcctgatcgatagcaag
tgccggctcaaagtggccgacttcggcctggctcgtaccctctcctcgaaacgcaaggcc
gacttcgatgaattggatcaggatggcatgttgacggattacgtagccacacggtggtat
cgcgcccccgaaatcctggtggccagtcgcagctataccaagggcatcgatatgtggggc
ctgggctgcattctgggcgagatgatcaggcagaagccactattccaaggcacgagcact
gtcaatcagattgagaaaatagtgactgccttgccggatgtgacacagctggacatcgat
tcgattggagccagcttcggcaccgtcctgctgggcaagaagatccatcgcgaccgccgc
cattcgctggacgagatgatgcggaactgctgcgacgatgccatttcgctggtgaagtcc
ctgctggtgctgaatccgcatctccggctgaccgccaaggcggccattcagcatccgtat
gtgagtcgcttccggaccgcgtcggcagacatggagctccgggtggacatccagccgccg
ctgagggacgatgtacgctacggtgtggaccagtaccgcaacaatctgtacgacatgata
ggtcgggagtcgaggggcagtgcccgcacggccagcaatgccacgccatccacgccgtcc
aatcgggacgaatcggcgaaaaccgtgcgagtcacgacccgagccagattgcgtcgcccc
tagcaaaggcgtgccacctccacggtcaccagcacatccaatctgcgacagctggacaca
tccaaggagcgggaggactccgtggagtccagcacagtgcagcgcccactgaaggagcga
ctgcatcgttccaggcagcgaaaggcacaccccatgcgcctcaatcagggccaaagccaa
tag

DBGET integrated database retrieval system