KEGG   Drosophila erecta: Dere_GG18986Help
Entry
Dere_GG18986      CDS       T01060                                 

Definition
GG18986 gene product from transcript GG18986-RA
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
der  Drosophila erecta
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 954 aa AA seqDB search
MSKPNNVPAHERRIHELDQTVERIFDVRKRLGKGAYGIVWKAIDRRQKSTVALKKIFDAF
RDDTDAQRTYREVIFLRAFRHHPNIIRLVDVFKAANNLDFYLVFEFMESDLHNVIKKGDV
LKDIHKRFVMYQLINAIKYMHSGNVIHRDLKPSNILIDSKCRLKVADFGLARTLSSKRKA
DFDELDQDGMLTDYVATRWYRAPEILVASRSYTKGIDMWGLGCILGEMIRQKPLFQGTST
VNQIEKIVTALPDVTQLDIDSIGASFGTVLLGKKIHRDRRHSLDEMMRNCCDDAISLVKS
LLVLNPHLRLTAKAAIQHPYVSRFRTASADMELRVDIQPPLRDDVRYGVDQYRNNLYDMI
GRESRGSARTASNATPSTPSNRDESAKTVRVTTRARTISANQSTASPAERRKEPYSCELN
QMRRKIKLVVSAPKTKAKEANRTETAAPQASLAPAPAAAPAAASAAPPTQGKTGEKTVHK
CRHNQVQIQRELAAVAAVATVPRRKKSTWQSQAQAQEKFHAEAKAQVQALLQTQKINIYD
SPPGLRQESYSQAEATVPPRRSRRLWQEKKPKEKSNKVEVTKPTVLTYRRREMYSTVEEK
MQRRQLEIQQKKEEEKAHRQKMKQEHELREKQRRRMTENYRLMEAERDQLEEMAKQEAQA
KAYKEIARKVWKLTARKEDDTLPKDQQDDSIIFTTGVSKCYRDRIRHLEQEMEKCKEQLL
DFVEEHRDLLNYGTLRYHLEKLTPLKREDEEEDGDNGRPLPEGSGDPGTQRYEIFRQEQE
KERQRQVQEFLARDETNEYDNLDLDNAYRAKYYQLFREIRGGSSSPDSGRRDSGSEQSPE
RDYTRDYAKYFPNYSDLDEDWKEPEHLLQSRRQQKRTEKSRRMKKRLEEQHQDRERLLAH
QKACQKQHEELGLHHKVHRHHHQHQHHAASGPRYDPMHLRENDIQEAYFSTDLN
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaccaaataatgttcccgctcacgagcgacgcatccatgagctggatcaaact
gtggaacgcatcttcgatgtgcgaaagcgcttgggtaagggtgcctatggcatcgtttgg
aaggccattgataggcgacagaagagcacggtggccctgaagaagatcttcgatgccttc
cgcgatgacaccgatgcccagcgcacctaccgtgaggtgatattcctgcgcgcctttcgc
caccatcccaacatcatacgactggtggacgtcttcaaggccgccaacaatttggatttt
tatttggtgtttgagttcatggaaagcgatctgcacaacgtgattaagaagggcgatgtc
ctcaaggacattcacaagcgattcgtcatgtaccagctgatcaatgccatcaagtacatg
cactcgggcaacgtcatccacagggacctgaagcccagcaacatcctgatcgatagcaag
tgccggctcaaagtggccgacttcggcctggctcgtaccctctcctcgaaacgcaaggcc
gacttcgatgaattggatcaggatggcatgttgacggattacgtagccacacggtggtat
cgcgcccccgaaatcctggtggccagtcgcagctataccaagggcatcgatatgtggggc
ctgggctgcattctgggcgagatgatcaggcagaagccactattccaaggcacgagcact
gtcaatcagattgagaaaatagtgactgccttgccggatgtgacacagctggacatcgat
tcgattggagccagcttcggcaccgtcctgctgggcaagaagatccatcgcgaccgccgc
cattcgctggacgagatgatgcggaactgctgcgacgatgccatttcgctggtgaagtcc
ctgctggtgctgaatccgcatctccggctgaccgccaaggcggccattcagcatccgtat
gtgagtcgcttccggaccgcgtcggcagacatggagctccgggtggacatccagccgccg
ctgagggacgatgtacgctacggtgtggaccagtaccgcaacaatctgtacgacatgata
ggtcgggagtcgaggggcagtgcccgcacggccagcaatgccacgccatccacgccgtcc
aatcgggacgaatcggcgaaaaccgtgcgagtcacgacccgagccaggacaattagtgcc
aaccaatcgaccgcaagcccggcggagaggaggaaggagccgtattcctgcgagctgaac
cagatgcgcaggaaaattaagctggtggtctccgcacccaagacgaaggcaaaggaggcc
aaccgcacggagaccgctgctccacaagcctcccttgctcctgcccccgcggctgctcct
gctgctgcttcagctgctccccctacacagggaaaaactggtgaaaaaactgtgcacaaa
tgccgacacaaccaagtgcagatccaacgggaattggctgccgtggcggccgttgcaact
gtgcctcggcgcaagaaaagcacctggcaatcgcaggcccaggcgcaagagaagttccac
gccgaagcgaaggcccaggttcaggctctgctccagacccagaagatcaacatctatgac
tcccccccgggattgcgccaagaatcctatagccaggcggaagctacagtgccccctcga
aggagtcgcagattatggcaagagaagaaacccaaagagaaatccaacaaagttgaagtc
accaagcccaccgttttgacataccgcagaagggagatgtattccacagtcgaggagaag
atgcagcgccggcagctggagatacagcagaagaaggaggaggaaaaggcgcaccggcag
aagatgaaacaggagcacgagctgagggagaagcagcgcaggcggatgaccgagaactat
cggcttatggaggcggagcgcgatcagttggaggagatggccaagcaggaggcgcaggcc
aaggcgtacaaggagatagcacggaaggtgtggaagctcactgcgaggaaggaggatgac
acgttgcccaaggatcagcaggatgattcgatcatctttaccacaggtgttagcaaatgc
tatcgcgatcggatcagacatctggagcaagagatggagaagtgcaaggagcagttgctg
gattttgtcgaggagcatcgcgatctgcttaactatggaacattgcgataccacttggaa
aagctgacgcccctaaagagggaggatgaggaggaggatggggacaacggtagacctctg
ccggagggcagtggtgatcccggcacccaaagatacgagatcttccgccaggagcaagag
aaggagcgacagcgccaggtgcaggagttcttggcccgcgacgagaccaatgagtacgat
aatctcgatctggacaacgcctaccgagccaagtactatcaactctttagggaaataagg
ggtggatcctcctcgccggacagtggaagacgcgactccggatcggagcagtccccggag
cgcgactacacgcgcgactatgccaaatactttcccaattactctgacctggacgaggat
tggaaagaaccggagcatctgttgcagtcccggcgtcagcagaaacgcacagagaagtcg
cgccggatgaagaagcgcctggaggagcaacatcaagaccgggaacgcctgctggcccat
cagaaggcctgccagaagcagcacgaagaattgggactccaccacaaggtgcaccgccac
catcaccagcaccagcaccacgcggccagcggacctcgctatgatcccatgcatctcagg
gaaaacgacattcaggaggcgtacttctccacggatctcaactga

DBGET integrated database retrieval system