KEGG   Drosophila erecta: Dere_GG19019Help
Entry
Dere_GG19019      CDS       T01060                                 

Definition
GG19019 gene product from transcript GG19019-RA
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
der  Drosophila erecta
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dere_GG19019
Enzymes [BR:der01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Dere_GG19019
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 277 aa AA seqDB search
MTSRQRTVIIFKSESESSDVYAETLEKHDFNPVFVPTLSFGFKNLEELRAKLQNPDKYAG
IIFTSPRCVEAVAESLNLGELPGGWKMLHNYAVGEVTHNLALSTLDQLFTHGKQTGNARA
LGEYIVDTFDGSRALPLLLPCGNLATDTLLSKLAENGFSVDACEVYETRCHPELGANVER
ALEIYGESIEFLAFFSPSGVNCAQQYFTSRQLSMDKWKLVAIGPSTRRALESQGLKVYCT
AERPTVEHLVKVLLNPQDSRERLLKERERMAALENNN
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgacgagtcgccagcgaactgtgattatattcaaatcggagtcggaaagcagcgatgtg
tacgcagaaacgctggagaagcacgatttcaatccggtgttcgtgcccacgctgagtttc
ggcttcaagaacctggaggagctgcgcgccaagctccagaatccggacaaatatgccggc
atcattttcacatcgccgcgctgcgtggaggctgtggctgaatccctgaatctgggcgag
ctgcccggcggttggaagatgttgcataactatgccgtcggcgaggtgacccacaatctg
gcgctgagcaccttggaccagctattcacccacggcaaacagacgggcaatgcccgggca
ttgggcgaatatatagtggacaccttcgatggatctcgtgcactgccgctgctcctgccg
tgcggcaatctggccaccgatacgctgctgtccaagctggccgagaatggcttctcagtg
gatgcctgcgaggtgtacgagacgcgctgccatcccgaattgggcgcaaatgtggagcgg
gcgctggagatctacggcgagtcaatcgaattccttgccttcttctcgccatcgggcgtc
aattgtgcgcagcagtacttcaccagccgccagttgtcgatggacaaatggaaactggtg
gccatcgggccgagcaccaggcgtgccctcgaatcgcagggcctgaaagtctactgcacc
gccgagcggccgacggtggagcacctggtcaaggtgctgctgaatccgcaggacagccgg
gagcggctgctcaaggagcgcgagcggatggcggccctcgagaataacaattaa

DBGET integrated database retrieval system