KEGG   Drosophila erecta: Dere_GG19029Help
Entry
Dere_GG19029      CDS       T01060                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
der  Drosophila erecta
Pathway
der00062  Fatty acid elongation
der01100  Metabolic pathways
der01212  Fatty acid metabolism
der04142  Lysosome
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    Dere_GG19029
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dere_GG19029
Enzymes [BR:der01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     Dere_GG19029
Lipid biosynthesis proteins [BR:der01004]
 Fatty acid synthase
  Component type
   Dere_GG19029
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest Abhydrolase_1
Motif
Other DBs
NCBI-GeneID: 6549720
NCBI-ProteinID: XP_001977411
FlyBase: FBgn0111235
UniProt: B3NUL5
Position
Unknown
AA seq 266 aa AA seqDB search
MGDTCCVPFSLGSIMSLIVEQTKGGYVRSLEIGGNVIMDWESGFFIHPNEQVDYVCKQLR
LDERLAQGYNAIGFSQGGQFLRAVAERCPNPPMRTLITLGGQHQGIFGLPMCPTLTLSSC
DYITRLLDNAAYAPEVQSKLVQATYWHDPIMENKYRLGSTFLADINNELIINEFYIENLH
KLKKFVMVQFLNDTIVQPKESQWFQYYTSGQNKVIQPFTESKVYQDLGLDKMHRQGKLIF
LGVEGDHLAISKAWFIQNIVPLLLEK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacacctgctgcgtgcccttcagcctgggttccattatgagcctgatcgtggag
cagacaaagggcggctatgtgcgatccctggagatcggcggcaatgttattatggactgg
gagagcggcttcttcatacatcccaacgagcaggtggattacgtttgcaaacaacttcgg
ctggatgagcgcctggcccagggatacaatgccatcgggttctcgcagggcggccagttc
ctgcgcgcggtggccgaacgatgtccgaatccgccgatgaggaccctcatcaccctcggc
ggacagcaccagggcatcttcgggctgcccatgtgcccaaccctaaccttaagctcctgt
gactacattaccaggctacttgacaatgccgcctacgcacctgaagtacagagtaagttg
gttcaggccacttactggcacgatccgatcatggagaacaaataccgcctaggcagcaca
tttctggcggacattaacaatgagctcatcatcaacgagttctacattgagaacctacac
aagcttaaaaaatttgtgatggtgcagttcttgaacgacacgattgtgcagccgaaggag
tcccagtggtttcaatactacaccagcgggcagaacaaagtcatccagccctttactgag
agcaaagtctatcaggatttgggattggacaagatgcatcgacaaggaaaacttatcttt
ctcggcgtcgaaggtgatcacttggccatatccaaagcctggtttatccaaaacatagtg
cctcttctactcgaaaaataa

DBGET integrated database retrieval system