KEGG   Drosophila erecta: Dere_GG19029Help
Entry
Dere_GG19029      CDS       T01060                                 

Definition
GG19029 gene product from transcript GG19029-RA
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
der  Drosophila erecta
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:der01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:der00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:der04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 266 aa AA seqDB search
MGDTCCVPFSLGSIMSLIVEQTKGGYVRSLEIGGNVIMDWESGFFIHPNEQVDYVCKQLR
LDERLAQGYNAIGFSQGGQFLRAVAERCPNPPMRTLITLGGQHQGIFGLPMCPTLTLSSC
DYITRLLDNAAYAPEVQSKLVQATYWHDPIMENKYRLGSTFLADINNELIINEFYIENLH
KLKKFVMVQFLNDTIVQPKESQWFQYYTSGQNKVIQPFTESKVYQDLGLDKMHRQGKLIF
LGVEGDHLAISKAWFIQNIVPLLLEK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacacctgctgcgtgcccttcagcctgggttccattatgagcctgatcgtggag
cagacaaagggcggctatgtgcgatccctggagatcggcggcaatgttattatggactgg
gagagcggcttcttcatacatcccaacgagcaggtggattacgtttgcaaacaacttcgg
ctggatgagcgcctggcccagggatacaatgccatcgggttctcgcagggcggccagttc
ctgcgcgcggtggccgaacgatgtccgaatccgccgatgaggaccctcatcaccctcggc
ggacagcaccagggcatcttcgggctgcccatgtgcccaaccctaaccttaagctcctgt
gactacattaccaggctacttgacaatgccgcctacgcacctgaagtacagagtaagttg
gttcaggccacttactggcacgatccgatcatggagaacaaataccgcctaggcagcaca
tttctggcggacattaacaatgagctcatcatcaacgagttctacattgagaacctacac
aagcttaaaaaatttgtgatggtgcagttcttgaacgacacgattgtgcagccgaaggag
tcccagtggtttcaatactacaccagcgggcagaacaaagtcatccagccctttactgag
agcaaagtctatcaggatttgggattggacaagatgcatcgacaaggaaaacttatcttt
ctcggcgtcgaaggtgatcacttggccatatccaaagcctggtttatccaaaacatagtg
cctcttctactcgaaaaataa

DBGET integrated database retrieval system