KEGG   Drosophila erecta: Dere_GG19260Help
Entry
Dere_GG19260      CDS       T01060                                 

Definition
(RefSeq) GG19260 gene product from transcript GG19260-RB
  KO
K14310  
nuclear pore complex protein Nup205
Organism
der  Drosophila erecta
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:der00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Dere_GG19260
Messenger RNA biogenesis [BR:der03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     Dere_GG19260
Chromosome [BR:der03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    Dere_GG19260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 2094 aa AA seqDB search
MDGEWAHCRATGQPCAGRQYTNAAHSVPSTGVTEDMWTPYKHLYSVFQATVSNPCAVTSD
LELCLKKYKHSFTNFLRNPAKSEKSRNYLRNALNEGVPLPGQSRKIKLSQDLVDEALILS
DMFDLDEVFAVELLCTAQRQQMHHPGLPRGLVAVLLYYDGRKAISCALRDMFLMVSGVSW
STELPREVTCLVTNYAQSLVDDSNILGRLLELLEEMDVDKECIMLTKNRAFGSKKHQNQV
IGLYEDIQQALAMALFHWSAQRGLPRPIAIRLLQHLANRKTNDADGNIDDVTLIMLMALL
YAYDTSVLLITEHTNPHTARLPILSDPEFAKCFLEALYAQSSWETPRLDAIITYSFGLTL
ASLRHAPGQLQAAALSTINRDEILIDEALGAQVFVFFYRLLLEKDLVYKTEFIYRRVHLL
ITDFIDFMNAKVSELRGRADESARTIISFLNEGLEPPPNLDSNFELLMLCVAKLYGDPRV
TIRLCNEYWGPSDPTGSTAFKNTSRSVSLFKFISLASELLPQTLFKSYLKMISGLTRTEF
SARCAFNMLKLPQATSGSYAVCWDHFFTSLGNYYNSMRNDFNTNISTGGETIYRSRSTPR
VITQREAEHLVAVMGIIQAVAEHDEISRIMICEQANWQTPQVLLGLVACATPLPLKAEIL
HTLAALAKSKETARVIWFHLEDSQIIPTLPVASSYGQCSLSEEIEQIESRSEQYNLTRGV
LQLLYTLMTTNMPKSLGVGPRKPGYDGYLKIVMNSVLLKFYNRAYKDPAEKWQVGAQCLK
LLYYLLATYRPNAMEFLETRDEHPYPGFHIMMQLQVKSDMLHLLLRIVEEVRERLDDYNR
FHGKELLEECSLYALLLLEAALAKQNAFFEAHSAANCPIMLSGLNRMLLDLNPRTRKPDH
VLNIVKFVTYNSWLPRHALAAVKILSAVTQLPNVSNQILSMYAQGSNEKLEIRQGFVECL
EMEVGMAQRRDELLDKLALNNHVPYLGFSDDMAKERERNGDRDDQTLELQLELEAEEAAL
ESKPASIELQLKDAIVQLFEINLSQQMPNFVYFLLGVDVLRDFMANGRQHLGIEMHCSCV
NSIVLLLEKYLDQQRHSEKYCEHTASIVERIYHLFHGLCANRRTTETILRYFRLTCNDFL
LRHLHSLPFRQHREDHVLHAMSHLLNCVSIDVKLAATHGQTTRYNQLCDILLMGNGTEAQ
RSFHGLPMEMGQNLINQSAPFLTMDLLPGGGSINAVGSGASSTPVGAPSTGAKALKPPLL
QETSQGLHATRLLDCLVLELDTLSQPQLEFFDTHLTTQLLRDCEASAEAGASSSANLINV
RKLYDILNGELRMVQSTIASGQRKAISKEIMILLKHAVNMNRVRAQRCATLAFMGAWGQL
VQVLFSSMPEAVLPVALRRQHIIDIVEKVLIKVQPIQPIIEISIQVSETVLLLLANLRYC
CYQVEDQSFEDQAADESLTNGNGIDSQAAKLSLAQRTIGNGSDGGCGAGREIGAGGNSSN
LRFILKNLVEWIMISEVKSQKLRINLYSALLNCLRIANRLRTDEQLEYQETLISRQESAR
ISSMELRRDDRQRLKAMAAEVIGTFGEKLIDTICHDAVTGHDVCRMLALACLDMISELHA
VSTLCDFVASRGYLKHILDSLGKSSEALSGILQPVPDHLRPLYVYESRMAFLTRMAKSNV
GARLLLAERALGVLSNMRVYDLQPDLKASELKRNEPQAFLPAIDERFRAILLPALALCDA
IVNTLGSCNNSAALQVLNFLFAHIDMVEAMLRTATPFMDLGHLQQLAVISNLFARTTTHE
VTALENSLDLENDLELRNRLGRLQQLMIVVFGRFCVSEATIRCMLQQDQEQTDQTEGSKT
LRVKYFLDIAANVSLYCRNVVTSHAKDSITSKYLLTTMINDVTPLTGKMDSKKLTAIMHT
ILNQLKGSIGYYLSQKSIADNLLQQRASLPNISFGPNGKQSYMDLSQRHNEKRSELMQAV
FIAEQNLYLLWIHLDFYLRNAIVYANENRNAINESNLDNGNNVSVLNASQDEILQLKQLL
ISTFNETFCTQLITASEDYTVKCKGFNGSLLRRIKALVQFAPITANGDNSTFAS
NT seq 6285 nt NT seq  +upstreamnt  +downstreamnt
atggatggtgagtgggcccactgccgggccactgggcagccgtgcgcagggcgccaatac
actaatgccgcccattccgtcccgtccacaggtgtgaccgaggacatgtggacgccgtac
aagcatctgtatagcgttttccaggcgactgtgtccaatccctgtgccgtcacctcggac
ctggagctgtgcctcaagaagtacaagcacagcttcaccaacttcctgcgcaatccggcg
aagagcgagaagagccgcaactacctgcggaatgccctgaacgagggcgtcccgctgccg
ggacaatcgcgaaagataaagctctcacaggatctggtggacgaggcgctcatactgtcc
gacatgttcgacctggacgaggtgttcgccgtggagctgctatgcaccgcacagcggcag
cagatgcatcatcccggcctgccacgaggccttgtggcggtgctgctctactacgatgga
cggaaggcgatcagctgcgccctgcgcgacatgttcctgatggttagcggcgtctcctgg
agcaccgagctgcccagggaggtcacctgtctggtcacaaactatgcccagagcctcgtc
gatgactcgaacatactgggacgcctgctggagctgctcgaggagatggacgtcgacaag
gagtgcattatgctgaccaaaaaccgcgcgtttggctccaagaagcaccagaaccaggtg
atcggcctgtacgaggacattcaacaggcactggccatggccctgttccactggtcagcc
cagcgcggcctgccgcgacccattgccatccggctgctgcagcacctggccaaccggaaa
accaacgacgcggacggcaacatcgacgacgtgaccctaatcatgctgatggctctgctg
tatgcgtacgatacctccgtgctgctgatcaccgagcacaccaatccgcacacagcccgc
ctgccgatcctcagcgatccggagttcgccaagtgcttcctggaggcgctgtacgcgcaa
agcagctgggaaacaccacgcttggacgccatcataacgtacagcttcggactcacgctg
gccagtctgcggcatgcacctgggcagctacaggccgccgccctctcgaccatcaaccgc
gatgagatcctcatcgacgaggcactgggagcgcaggtattcgtattcttctaccggctg
ctcctcgagaaggatctggtctataaaacggagttcatctaccgccgagtccatctgctc
atcacggacttcatcgacttcatgaacgccaaggtgtcggagctacgcggccgagcggac
gagtcggcacgcacgatcatcagcttcctgaacgagggtctggagccgccgcccaacctg
gactccaactttgagctgctcatgctgtgcgtggccaagctgtacggcgatccgcgggtc
accatcaggctgtgcaacgagtactggggccccagcgatcccaccggctccacggcgttc
aagaacacctcgcgctcggtgtccctgttcaagttcatcagcctggccagcgagctgctg
ccacagacgctgtttaaatcctacctcaagatgatttctggactcacacgcaccgagttc
tcggcacgctgcgccttcaacatgcttaagctgccccaggcgacctccggcagctatgct
gtctgctgggatcactttttcacgtcactgggcaactactacaactcgatgcggaacgac
ttcaacaccaacatcagtacgggcggcgagaccatttaccgcagccgatcgacgccaagg
gtcatcacgcagcgggaggcggagcacctggtggccgtgatgggcattatacaggccgtt
gccgagcacgacgagatctcgcgcatcatgatctgtgagcaggccaactggcagacgccg
caggtgctcctgggcctggtggcgtgcgccacgccgctgccgctcaaggctgagattctg
cacacgctggctgccctggccaaatccaaggagacggcgcgcgtcatctggttccacctg
gaggactcgcagataatacccaccttgcccgtggccagcagctatggccagtgcagcttg
tcggaggagatcgaacaaatcgagagccgttcggagcagtataacctgacgcgaggcgtc
ctgcagctgctctacacactgatgaccaccaacatgccgaagagtttgggcgtggggcca
cggaagcccggctacgatggctacctcaagatcgtgatgaattcggtgctgctcaagttt
tacaatcgagcgtacaaggatcccgccgagaagtggcaggttggcgcccagtgcctgaag
ctgctctactatctgctggccacctaccggccgaacgcaatggaattccttgagacgcgc
gacgagcatccctaccctggtttccacatcatgatgcagctgcaggtgaagtccgatatg
ctgcatctgctgctgcgcatcgtggaggaggtgcgtgagcggctggacgactacaaccgc
tttcacggcaaggagctactcgaggagtgctccctgtacgcactgctgctcctcgaagcc
gcgctggcgaagcagaacgccttcttcgaggcccactcggcggccaactgccccatcatg
ctgtccggcctaaatcgcatgctcctggacctgaatccacgcacccgcaagccggatcac
gtgctgaacatcgtcaagttcgtgacctacaacagctggctgccgcgccacgcgctggca
gccgtcaagatcctgagtgcggtcacccagctgccgaatgtctctaaccagatcctcagc
atgtacgcccagggcagcaatgagaagctcgagatccggcagggcttcgtcgagtgcctg
gaaatggaggtgggcatggcccagcgcagagacgagctgttggacaagctggccctcaac
aatcacgttccgtatttgggcttcagcgatgacatggccaaggagcgggagcggaacggg
gatcgcgacgatcagactttggaattgcaactggagctggaggcggaggaggccgctctg
gagagcaagccggccagcatcgagctgcaactgaaggatgccattgtccagctgttcgag
ataaatctcagccagcagatgccgaactttgtgtacttcctgctcggcgtggacgtgcta
cgcgactttatggccaacgggcggcagcacctgggcatcgagatgcactgctcgtgcgtg
aactccatagtgctgttgctggaaaagtacctggatcaacagcggcacagcgagaagtac
tgcgagcacacggctagcatcgtggagcgcatttaccatctgtttcacggactatgcgcc
aatcgtcgcaccacggagacgatactgcgctactttcgactgacatgcaacgacttcctg
ctgcgacacctccactcgctgcccttccggcagcatcgcgaggatcacgtgctgcacgcc
atgagccacctgctcaactgcgtttccatcgacgtcaaactggcggccacacatggacag
acgacgcgctacaaccagctgtgcgacattctgctaatgggaaacggaacggaggcacag
cgctcattccacggtctgccaatggagatgggccagaacctgataaaccagtcggcgccg
ttcctcaccatggatctgctgccgggcggaggatcgataaatgccgtcggctccggggcg
agctcgacacctgtcggagcaccaagtactggggccaaagccctgaagccaccgctgctg
caggagacatcgcaggggctgcacgccacccggctgctagattgcctcgtcctggagttg
gacacgctgagccagccgcagctggagttcttcgacacgcatctcaccacccaactgctg
cgcgactgcgaggcatccgcagaagctggcgccagttccagcgccaacttgatcaacgtg
cgcaaactgtacgacattcttaacggcgaactgcgaatggtgcagagcaccattgccagc
ggccagcggaaggccatctccaaggaaatcatgatactgctcaagcacgccgtcaacatg
aaccgggtgcgggcacagcgctgcgccacgctggccttcatgggagcatggggtcaactg
gtgcaggtgctcttcagcagcatgcccgaggccgtgctgccggtggcgctgcgccgccaa
cacattattgacatcgtcgagaaggtgctcatcaaggtgcagcccattcagcccatcatc
gagatctccatccaggtgagcgagacggtgctgctgctcctggccaatctgcgctactgc
tgctaccaggtagaggatcagagcttcgaggatcaggccgccgacgagtcgctcaccaat
ggcaacggcatcgattcccaggccgccaaactgagtctggcccagaggaccatcggcaat
ggttcggatggaggatgcggagccgggcgggaaatcggtgccggtggcaacagcagcaat
ctgcgattcatcctcaagaacctcgtcgagtggatcatgatcagcgaggtcaagtcgcag
aagctgcgcatcaatctgtacagtgccctgctgaattgcctgcggattgcgaatcgactg
cgcaccgacgaacagctggagtatcaggagacgctcatttcgcgccaggagagtgcccgc
ataagcagcatggagctgcggcgcgacgaccgccagcggctgaaggccatggcggcggaa
gtgattggcaccttcggcgagaagctgatcgacaccatctgccacgacgcggtgaccggg
cacgatgtgtgccgcatgctggcgctggcctgcctggacatgatttccgagctgcacgcg
gtgagcacgctgtgcgactttgtggcgtcgcggggctacctcaagcacatactggacagc
ctgggcaagtccagtgaggcgctgtccgggattctgcagcccgtgccggaccacctgagg
ccgctctacgtgtacgagtcgcgcatggccttcctcacgcgcatggcaaagagcaatgtg
ggcgcccgactcctcctcgccgaacgggcgctgggcgtgctctcgaatatgcgggtctac
gacctgcagcccgacctgaaggccagcgagctaaagcggaacgagccgcaggccttcctg
ccggccatcgatgagcgcttccgggcgatcctcctgccggcactggccctctgcgatgcc
attgtgaacacgctgggatcgtgcaacaactctgccgccctgcaggtgctcaacttcctg
ttcgcccacatcgacatggtggaggccatgttgcgcacagccacgccattcatggacctg
ggccacctgcagcagctggcggtcatcagcaatctgtttgcccgcaccaccacgcacgag
gtgaccgcgctggagaacagcctcgacttggagaacgatctagagctgcgcaatcgtcta
ggccgcctgcagcagctgatgatcgtcgtgtttgggcgcttctgcgtaagcgaggccacc
attcggtgcatgctgcagcaggaccaggagcagaccgaccagactgagggctcaaagacg
ctacgcgtcaagtatttcctggacatagccgccaacgtgtcgctctactgccgcaatgtg
gtcaccagccatgcgaaggacagcattacttccaagtatttgctgaccaccatgatcaac
gatgtgacgcccctcactggcaaaatggacagcaagaagctgacggccatcatgcacacc
atcctcaaccagctgaagggctccatcggctactacctctcgcagaagtcgatcgccgac
aatctcctccagcaacgcgcctccctgcccaacatcagctttggccccaacggcaaacaa
agctatatggacttgagccagcggcacaacgagaagcgcagcgaactgatgcaggccgtc
ttcatcgccgagcagaacctgtatctgctgtggatccatctggacttctatctgcgcaac
gccatcgtctacgccaacgaaaataggaacgccatcaatgagagcaacctggacaacggc
aacaacgtgtccgtgctgaacgcctcccaggacgagatcctgcagctcaagcagctgctc
atctccaccttcaacgagaccttctgcacgcagctaatcacggccagcgaggactacacg
gtcaagtgcaagggctttaacggctcgctgctccgccgcatcaaggcgctcgtccagttc
gcccccatcactgccaatggcgacaattccaccttcgcctcctag

DBGET integrated database retrieval system