KEGG   Drosophila erecta: Dere_GG19306Help
Entry
Dere_GG19306      CDS       T01060                                 

Definition
(RefSeq) GG19306 gene product from transcript GG19306-RH
  KO
K06091  
MAGUK p55 subfamily member 5
Organism
der  Drosophila erecta
Pathway
Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:der00001]
 Environmental Information Processing
  Signal transduction
   04391 Hippo signaling pathway -fly
    Dere_GG19306
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 1367 aa AA seqDB search
MRILKQWNRRRSGSSIVVLDGDDLKPCLPDDYISGQHHLNHQQQLQLQQQLQQQHPLQQQ
HYRTHSGDIREIDQEMLTMLSVNQDNGPHREMAVDCPETFIARNKTPPRYPPPRPPQKHK
KSTTTTTTTTITAMTNNDHANKMLIVAYHSSHQHEQLQQQQPPHHEQQQQQHPSKTTTTT
TIALDVATQNLYNQKQQNKLEQIENYENCLQSEQHEQHEQQKQHQVTTAVAATQVAQQQT
PSHKLQATLSSDPNGNSNSNTVGSSSSNNSSITDDFLCVVDGLYQGRKDSASPSSSAFDE
VMSKHTLDSFGSIAYRHLHQQHQATSNGNSSNTSNTNSNGNTSNSTAVSTKAPAVAKTGA
SSGNSNSNSLNSSNSSMHTSSSSSGHSSNIASATSSSSSATSSSTVPDDLSLAPPGYEVS
QQQQQQQHLVAAPVAMLLPPLAKHRELPVDVPDSFIEMVKTTPRYPPPAHLSSRGSLLSN
GSASTAHTTLSSMGVSHSPVTATAATAAATAAATAAATSTTSACAATAVAAAAAVSGVAD
GDAKRVADELNGNAKPVPPPRDHLRVEKDGRLVNCSPAPQLPDRRGPGNGSSGSSSGATT
HPLQHQQIAQIVEPTLEQLDSIKKYQEQLRRRREEEERIAQQNEFLRNSLRGSRKLKALQ
DTATPGKAVAQQQQQATVATQVVGVENEAYLPDEDQPQAEQIDGYGELIAALTRLQNQLS
KSGLSTLAGRVSAAHSVLASASVAHVLAARTAVLQRRRSRVSGPLHHSALGLQKDIVELL
TQSNTAAAIELGNLLTSHEMEGLLLAHDRIANHTDGTPSPTHSPIPAVGVATGSTISSPV
AGPKRNLGMVVPPPVVPPPLAQRGAMPLPRGESPPPVPMPPLSTIPLSMPVNLPMSACFG
TLNDQNDNIRIIQIEKSTEPLGATVRNEGEAVVIGRIVRGGAAEKSGLLHEGDEILEVNG
QELRGKTVNEVCALLGAMQGTLTFLIVPAGSPPSGGVMGGTTGSQLAGLGGAHRDTAVLH
VRAHFDYDPEDDLYIPCRELGISFQKGDVLHVISREDPNWWQAYREGEEDQTLAGLIPSQ
SFQHQRETMKLAIAEEAGLARSRGKDGSGSKGATLLCARKGRKKKKKASSEAGYPLYATT
APDETDPEEILTYEEVALYYPRATHKRPIVLIGPPNIGRHELRQRLMADSERFSAAVPHT
SRARREGEVPGVDYHFITRQAFEADILARRFVEHGEYEKAYYGTSLEAIRTVVASGKICV
LNLHPQSLKLLRASDLKPYVVLVAPPSLDKLRQKKLRNGEPFKEEELKDIIATARDMEAR
WGHLFDMIIINNDTERAYHQLLAEINSLEREPQWVPAQWVHNNRDES
NT seq 4104 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcctaaagcaatggaatcgccggcgctccggatcgagcattgttgtgctggat
ggcgacgatttgaagccatgtctgccggatgactacataagcggccagcaccatctgaac
caccagcagcagctgcaactacagcagcagctgcagcagcagcatccgctccagcagcaa
cactatcgcacgcactcgggcgacatcagggagattgaccaggaaatgctgaccatgctg
tccgtgaaccaagataacggtccacaccgtgagatggccgtcgattgtccggagacgttc
atcgcacgcaacaagacgccaccccgatatccgccaccccgtccaccacagaaacacaag
aaaagcaccaccaccaccaccaccaccacaatcacagctatgactaacaatgatcatgct
aacaaaatgttaattgttgcatatcattcttcacatcaacatgaacaactacaacaacaa
caaccaccacatcatgaacaacaacaacaacaacacccatctaaaacaacaacaacaaca
acaattgcactcgatgtggccacccaaaatttgtacaaccaaaaacaacaaaacaaattg
gaacaaatcgaaaactatgaaaattgcctgcaatcggaacaacacgaacaacatgagcaa
cagaagcaacaccaagtgacaaccgcagtggcagcaacacaggtggcacaacagcagacg
cccagccacaagttgcaggcgacattgagcagcgatccgaacggcaacagcaacagcaac
accgttggcagcagcagcagcaacaacagcagcatcacggacgacttcctgtgcgttgtg
gatgggctgtatcagggacgcaaggactcggcctcgccctcatcgagtgccttcgatgag
gtgatgagcaaacacaccctggactccttcggcagcatcgcctatcgtcacctgcaccag
caacaccaggcgacgagcaacggcaacagcagcaacacgagcaacaccaacagcaatggc
aacacgagcaacagcacagctgtttcgaccaaagcaccagcggtagccaaaacaggtgcg
agcagcggcaacagcaacagcaactcgctgaacagcagcaacagctcgatgcacaccagc
agcagcagcagcgggcacagcagcaacatagccagtgccacatcatcatcctcctccgcc
accagcagctcaacggtgcccgatgacctgagcctggcgccgcccggctacgaggtgagc
cagcagcaacagcagcagcaacatttggttgcagctcccgtggcaatgttgctgccaccg
ctggccaagcatcgcgagttgcccgtggacgtgccggacagctttatcgagatggtcaag
actacgccaagatatccgccaccagctcacctctcctcgcgcggatcgctgttgtcgaac
ggcagcgcctccaccgcccacaccacgctctcctcgatgggcgtgtcgcattcgcctgtc
actgcaacagcagcaacagcagctgcaacagcagcagcaacagcagcagcaacatcaacg
acatcagcatgtgcagccactgctgttgctgctgctgctgcggtttctggcgttgctgac
ggcgatgcgaagcgggtggccgatgagctcaatgggaacgccaagcccgtaccaccgcca
cgtgatcatctgcgggtggagaaggacgggcggctggtcaactgctcccccgcacctcag
cttccggatcgcagggggccggggaatgggagcagcgggagcagcagtggcgcaacaacg
catccgctgcagcaccagcagatcgcccagattgtggagcccactttggagcagctggac
agcatcaagaagtaccaggagcaattgcgccgacgacgcgaagaggaggagcgcatagcg
cagcaaaatgaattcctgcggaatagtcttcgtggctcccggaagctgaaggcgctccag
gatacggccacgcccggaaaagcggttgcccagcagcaacagcaggcaacggtggccacc
caggtggttggcgtggagaatgaggcatatctgcccgacgaggaccagccgcaggcggaa
cagattgatggctatggcgagctgatagcggccctcacccgcctgcaaaaccagctgagc
aagagcggactgagcacgctggcgggtcgagtttcggctgctcacagtgtcctggccagc
gccagtgtggcccatgtcctggccgctcgcaccgcagtcctccagcgacgacgttcccgc
gtctctggtccactacatcacagtgccctgggattgcagaaggatatcgtggagctgctc
acgcaatcgaatactgcagcggccattgagctgggcaacctgctgaccagccatgaaatg
gagggtctgctcctggcccacgatcgcattgccaatcacacggatggcacgccctcgcct
acccactcgcccattccggcagttggagtggcgacgggatccacaatcagcagtccggtg
gctgggcccaagcgaaacctaggtatggtggtgccaccgcccgtcgtcccacccccactg
gcgcaacgtggagcaatgccactgccgcggggggagtcgccaccaccggttcccatgcca
ccactgtccacaatacccttgtccatgcccgtcaatctgccaatgagtgcgtgctttggc
acgctaaacgatcagaacgacaacatccggatcatccagatcgagaagtccacggagccg
ttgggcgccacggtacgcaacgagggtgaggcggtggtcatcggcaggattgtgcgtggt
ggagcggcggagaagtcgggactgctgcacgaaggcgacgagatcctggaggtcaacggt
caggagttgcgtggcaagacggtgaacgaggtgtgcgcccttttgggcgccatgcagggc
accctgaccttcctgatcgttcccgcgggtagtccgccgtccggcggcgtaatgggcgga
actacgggcagccaactggccggactgggtggagcacaccgcgacaccgccgttttgcac
gtccgggcgcacttcgactacgatccagaggacgatctgtatataccctgccgggagctg
ggcatcagcttccagaagggcgatgtgctgcacgtgatcagccgcgaggatcccaactgg
tggcaggcgtatcgcgagggcgaggaagaccaaacgctggctggtcttattcctagtcag
tcgttccagcatcagcgcgagaccatgaagctggccattgcggaggaggcgggactggcc
cggtcccgcgggaaggacggatcaggcagcaaaggagccacactcctatgtgcgcgcaag
ggtcgcaaaaagaagaagaaggccagctccgaggcgggatatcccttgtacgccaccacg
gcgccggatgaaacagatccggaggagatactcacctacgaggaggtggctttgtactat
ccccgcgctacccacaagcggcccattgtcctcatcggaccgcccaacatcggaagacat
gagttgcgccaacgcctgatggccgactcggagcgtttctccgccgcagtgccacataca
tcacgagcccgcagggagggcgaagtgcccggagtggactaccacttcatcacgagacaa
gccttcgaggcggatattctggcgcgccgctttgtggagcacggtgaatacgagaaggcc
tactacggcacatcactggaggccatacgcacggtggtggccagcggcaagatctgtgtg
ctcaacctgcatccgcagagcctcaagctgctgcgcgcctctgacctcaagccgtatgtg
gtgctggtggcgccgcccagcttggacaagctgcgccaaaagaagctacgcaacggtgaa
cccttcaaggaggaagagctcaaagacatcattgccacggccagggatatggaggcccgt
tggggtcacctattcgacatgatcatcattaacaacgacacggagcgcgcctaccaccaa
ctgctggccgagatcaactcgctggagcgcgagccccaatgggtgcccgcccagtgggtg
cacaacaatcgcgacgagtcataa

DBGET integrated database retrieval system