KEGG   Drosophila erecta: Dere_GG19369Help
Entry
Dere_GG19369      CDS       T01060                                 

Definition
GG19369 gene product from transcript GG19369-RA
Orthology
K04646  
clathrin heavy chain
Organism
der  Drosophila erecta
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:der00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Dere_GG19369
   04142 Lysosome
    Dere_GG19369
Exosome [BR:der04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dere_GG19369
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1678 aa AA seqDB search
MTQPLPIRFQEHLQLTNVGINANSFSFSTLTMESDKFICVREKVNDTAQVVIIDMNDATN
PTRRPISADSAIMNPASKVIALKAQKTLQIFNIEMKSKMKAHTMNEDVVFWKWISLNTLA
LVTETSVFHWSMEGDSMPQKMFDRHSSLNGCQIINYRCNASQQWLLLVGISALPSRVAGA
MQLYSVERKVSQAIEGHAASFATFKIDANKEPTTLFCFAVRTATGGKLHIIEVGAPPNGN
QPFAKKAVDVFFPPEAQNDFPVAMQVSAKYDTIYLITKYGYIHLYDMETATCIYMNRISA
DTIFVTAPHEASGGIIGVNRKGQVLSVTVDEEQIIPYINTVLQNPDLALRMAVRNNLAGA
EDLFVRKFNKLFTAGQYAEAAKVAALAPKAILRTPQTIQRFQQVQTPAGSTTPPLLQYFG
ILLDQGKLNKFESLELCRPVLLQGKKQLCEKWLKEEKLECSEELGDLVKASDLTLALSIY
LRANVPNKVIQCFAETGQFQKIVLYAKKVNYTPDYVFLLRSVMRSNPEQGAGFASMLVAE
EEPLADINQIVDIFMEHSMVQQCTAFLLDALKHNRPAEGALQTRLLEMNLMSAPQVADAI
LGNAMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHMLNAEWLVSFFGTLS
VEDSLECLKAMLTANLRQNLQICVQIATKYHEQLTNKALIDLFEGFKSYDGLFYFLSSIV
NFSQDPEVHFKYIQAACKTNQIKEVERICRESNCYNPERVKNFLKEAKLTDQLPLIIVCD
RFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVVGGLLDVDCSEDIIKNLILVVKGQ
FSTDELVEEVEKRNRLKLLLPWLESRVHEGCVEPATHNALAKIYIDSNNNPERYLKENQY
YDSRVVGRYCEKRDPHLACVAYERGLCDRELIAVCNENSLFKSEARYLVGRRDAELWAEV
LSESNPYKRQLIDQVVQTALSETQDPDDISVTVKAFMTADLPNELIELLEKIILDSSVFS
DHRNLQNLLILTAIKADRTRVMDYINRLENYDAPDIANIAISNQLYEEAFAIFKKFDVNT
SAIQVLIDQVNNLERANEFAERCNEPAVWSQLAKAQLQQGLVKEAIDSYIKADDPSAYVD
VVDVASKVESWDDLVRYLQMARKKARESYIESELIYAYARTGRLADLEEFISGPNHADIQ
KIGNRCFSDGMYDAAKLLYNNVSNFARLAITLVYLKEFQGAVDSARKANSTRTWKEVCFA
CVDAEEFRLAQMCGLHIVVHADELEDLINYYQNRGYFDELIALLESALGLERAHMGMFTE
LAILYSKFKPSKMREHLELFWSRVNIPKVLRAAESAHLWSELVFLYDKYEEYDNAVLAMM
AHPTEAWREGHFKDIITKVANIELYYKAIEFYLDFKPLLLNDMLLVLAPRMDHTRAVSYF
SKTGYLPLVKPYLRSVQSLNNKAINEALNGLLIDEEDYQGLRNSIDGFDNFDNIALAQKL
EKHELTEFRRIAAYLYKGNNRWKQSVELCKKDKLYKDAMEYAAESCKQDIAEELLGWFLE
RDAYDCFAACLYQCYDLLRPDVILELAWKHKIVDFAMPYLIQVLREYTTKVDKLELNEAQ
REKEDDSTEHKNIIQMEPQLMITAGPAMGIPPQYAQNYPPGAATVTAAAGRNMGYPYL
NT seq 5037 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaccactgcccatccgctttcaggagcatttacagctcacaaatgtcgggatc
aacgccaattcattttcatttagcacgcttacgatggaatcggataagtttatttgcgtg
cgggagaaggtgaatgataccgcccaagtggtcatcattgacatgaacgacgccaccaat
cccacgcggcgtcccatctcagcggattcggctatcatgaatccagctagcaaggtcatt
gcactcaaagcgcaaaagacgttgcagatcttcaacattgagatgaagtcgaaaatgaag
gctcataccatgaacgaggatgtggtgttctggaagtggatctccctcaacacgctagct
ctggtcacagaaacgagtgtgttccattggtccatggaaggcgattcgatgccgcagaag
atgtttgaccggcattcatcgctgaacgggtgtcaaatcatcaactaccgctgcaatgcc
tcccagcagtggcttctcctggtcggcatttcggctctgccgagtcgcgttgccggtgcc
atgcagttgtattcggtggagcgcaaggtctctcaggccatcgaggggcacgcggccagc
tttgccacgttcaaaatcgatgccaacaaagagccaaccactctgttctgctttgctgtg
cgcacggccactgggggcaagcttcatattatcgaagttggtgctccgccgaacggcaat
cagccgtttgccaagaaggctgtcgatgtcttctttccgccggaagcacaaaatgatttc
ccagtggcaatgcaagtctctgcgaagtacgacaccatttacttgataaccaagtatgga
tacatacatctgtatgacatggagacggccacgtgcatatacatgaatcgtatatcggcc
gatacgatctttgttaccgcaccgcatgaggcaagtggtggcatcattggcgtcaatcgc
aagggacaggtcctttccgtgaccgtcgacgaggagcagatcattccctacatcaacact
gttctgcagaatcccgatttggcccttcgcatggctgtgcgcaacaatttggccggcgcc
gaagatctctttgtgcgaaagttcaacaagctctttacagccggccagtatgccgaggcg
gctaaagttgcggccctggcacccaaggccattctgcggacgccacagacgatccagcgt
ttccaacaggtgcagacaccagctgggtccacgactccgccgctgctgcaatactttggc
attctcctggaccagggcaagctgaacaagttcgagtccctggagctgtgccgaccagtc
ttgctgcagggcaagaaacagttgtgcgagaagtggctgaaggaggagaagctggagtgc
agcgaggagttgggagatctggtaaaggcctccgatcttacgcttgccctctccatctat
ctacgtgcaaacgttcccaacaaggttatccaatgttttgctgagaccggacaattccag
aagattgttctctacgccaagaaagtcaactatacgcccgattacgttttcctgctgcgc
tccgtgatgcgaagcaacccggagcagggagctggtttcgcctccatgttggtggccgag
gaagagcccctggcggacatcaatcagattgtggacatcttcatggagcactccatggtg
cagcagtgcactgcattcctgctggacgccctcaagcataaccgacccgctgagggtgcc
ctccagacgcgcctgctggaaatgaatctgatgtctgctccgcaggtggccgacgccatc
ctgggcaacgctatgttcacccactacgatcgggcacacattgcccagctgtgcgagaag
gcaggactgctccagcgcgccctcgagcactacacggatctgtatgacattaagcgggcc
gtggtgcacacgcatatgctgaacgccgaatggctggtcagtttcttcggcactctgtcg
gtggaggactcactggaatgtctgaaggcaatgcttacggcgaatttgcgtcagaacttg
cagatctgtgtgcagattgccaccaagtaccacgaacagctgaccaacaaggcactgatt
gacctgttcgaaggtttcaagagctacgacggactgttctacttcctgagcagcattgtc
aacttctcacaggatccagaagtgcacttcaaatacattcaggcggcctgcaagactaat
cagattaaggaggtggagcgcatttgccgcgaatcgaactgctacaatcccgaacgggtg
aagaacttcttgaaggaggccaagctgacggatcagttacctttaattattgtttgtgat
cgtttcgattttgtgcacgacttagtgctttatctgtatcgtaacaatctgcagaagtac
atcgaaatttatgtgcagaaagtgaatccatcccgcttgcctgttgttgtgggtggactt
cttgatgttgattgtagtgaggatataatcaaaaatctaattcttgttgtcaagggacaa
ttctcaaccgacgagctcgtcgaagaggtcgagaagcgcaaccgtctcaagctcctcctt
ccctggctggagtcccgagttcacgagggctgcgttgagccagccacccacaatgccttg
gccaagatctacattgactcgaacaacaatcccgagagatatcttaaggagaatcagtac
tacgatagccgtgtggtcggtcgctactgcgagaagcgggatccccatttggcgtgtgtt
gcctacgagcgtggattgtgcgatcgcgagctgatcgccgtttgcaacgagaactcactg
ttcaaaagcgaagcacgctatttggttggtcggcgcgacgccgaactctgggctgaggtc
ctttcggagagcaatccctacaagcgccagttgatcgatcaggtggtgcagacggctttg
tccgagacccaggatcccgatgacatctctgtaacggtcaaggcattcatgaccgccgat
ttgcccaatgagctcatcgaacttctagagaagattattctggactcgtccgtctttagc
gaccatcgcaatctgcagaacttgcttattcttacagccatcaaggctgatcgcacccga
gtaatggactacatcaacaggctggagaactacgatgctccggatatcgcgaacattgcg
atcagtaatcagttgtacgaagaagcctttgccatcttcaagaagttcgatgtgaacaca
tcggccattcaggtgctcatcgatcaagtgaacaacctggagcgggccaacgagttcgcc
gagcggtgcaatgagccggccgtttggtcgcagctggccaaggcccaactgcagcagggt
ttggtcaaggaggctatcgattcgtacatcaaggctgatgatccgagcgcctacgtcgat
gtcgtcgatgtggccagcaaggtggagtcgtgggatgacctcgttcgctatctgcaaatg
gcacgcaagaaggcacgcgaatcttacatcgagagcgaattgatttatgcctatgctcgc
actggacgtctggccgatctggaggagttcatttcgggtcccaaccatgccgatatccag
aagattggcaaccgttgcttcagcgacggcatgtacgatgcagcgaagcttctgtacaac
aatgtgagcaactttgctcgtctggccattactttggtctacttgaaggagttccaaggg
gccgtggactcggcgcggaaagccaactcaacgcgcacatggaaggaggtgtgtttcgcc
tgcgtggacgccgaggagtttaggctagctcagatgtgtggtctgcacattgtggtgcat
gccgatgagctggaggatctgattaattactatcagaaccggggatatttcgatgaattg
attgcgctactcgagtcggctttgggactggaacgtgcgcacatgggaatgttcaccgaa
ttagctatactttattcaaaattcaaaccttccaaaatgcgagagcacttggagctgttc
tggtctcgcgttaacattccaaaagttctgcgtgccgctgaatcggctcacttgtggtcg
gagctggtattcctgtatgacaagtacgaggagtacgacaacgctgtcctggccatgatg
gcccatcccacggaggcgtggcgtgagggccacttcaaggacatcatcaccaaggtggcc
aacattgagttgtactacaaggccatcgaattctatttggacttcaagcctctgctgttg
aacgatatgctcctcgtgctggcacccagaatggatcacactcgtgctgttagttacttc
tccaagaccggctatttgcccctcgtcaagccttatctgcgttcagtccaatctctcaat
aacaaggcaattaacgaagccctgaacggactcttaatagacgaggaggactaccagggt
ctgcgcaactcgatcgatggatttgacaactttgataacattgcgttggcacagaaactt
gaaaagcacgaacttaccgaattccgtaggattgccgcctacttgtacaagggaaataac
cgctggaaacagagcgttgagctctgcaaaaaggacaaactctacaaggatgctatggag
tacgccgccgaatcttgcaagcaagatattgccgaggagttgttgggttggttcctagaa
cgtgacgcttacgattgttttgcagcttgtctttatcagtgctacgacttgctgcgccct
gatgtcattttggagttggcctggaaacataaaatcgtggactttgccatgccctattta
atccaggttctgcgggaatacacaacaaaggtggacaaactggagttaaacgaagctcag
cgcgagaaggaggacgactcaactgagcacaaaaacattattcagatggagccccaactg
atgatcaccgctggcccagcaatgggaatacctccacaatatgcacagaattatccaccc
ggtgcagcaacggtaacagcggcagcaggacgcaacatgggctatccctacttgtag

DBGET integrated database retrieval system