KEGG   Drosophila erecta: Dere_GG19484Help
Entry
Dere_GG19484      CDS       T01060                                 

Definition
GG19484 gene product from transcript GG19484-RA
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
der  Drosophila erecta
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dere_GG19484
   00052 Galactose metabolism
    Dere_GG19484
Enzymes [BR:der01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Dere_GG19484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 391 aa AA seqDB search
MVKVVEDIFGIATNPFTKQAQVIRRYTMTNSNRLSVAVIQLGATIQSIQVPDAYHQMSDV
VLGFDDVAGYMKYRNYHFGCTLGRVSDVVGNGEFIMDERRVIVSKNLGQKHQIDGGFVGF
DQVIWDLEMKRPDGVTLRHVSPDGHEGYPGTLKVLLHFTIDDDNRFFIQIEATTNQTTPV
NISNHIIFNLAGQSTGIDGIFDHQINIEAMETMETSGGDALPTGRFKNVDDSVYDIRLPV
FMGDRVRQFEQRPVKGYDVCFALDKKFDAIKTRYVGRFLHPESGRFMEIFSNQPCVKFTT
GNCFPQEPLGEPPILGKRCTRYWQHCGFSLQLLNYPDAVNQPDFPRIFFNPGDLYYHETI
YHFGVQESWKCCADPEELEALGEEPLRKSKV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaggttgtggaggacatttttgggattgcgaccaatccgtttaccaagcaggcc
caagtgattcgtcgctacacaatgaccaactccaatcgcctatccgtggccgtcatccag
ctgggcgccacaatccagagcatccaagtgccagatgcctatcaccagatgtccgatgtg
gtccttggattcgatgatgtagccgggtatatgaagtataggaattaccattttggttgc
acgctcggcagagtctcggatgtggtgggtaacggagagtttatcatggacgagcgacgg
gtcattgtgtcaaaaaatctcggccagaagcatcagattgatggtggctttgtggggttc
gatcaggtcatttgggatctggaaatgaagcggccggatggcgtcaccttgcggcatgta
tcgccggatggacacgaaggatatcctggcaccctgaaagtattgcttcacttcaccatc
gatgacgacaatcggttttttatacaaatcgaagccaccactaaccaaacgacgccggtg
aatatatccaatcatatcatctttaatctggccggccagtccaccggaatcgatggcatt
tttgatcatcaaatcaacattgaggcaatggaaacgatggaaacttctggtggcgacgca
ctgcccacgggtcggtttaagaacgtcgatgattccgtatacgatatccgattgccagta
tttatgggcgatcgagtgcgtcagtttgaacagagaccggtgaaggggtacgatgtttgc
tttgctctcgacaagaagtttgatgcaatcaaaacgcgttacgtgggcaggtttttgcat
ccggaatcgggcagatttatggagatatttagcaatcagccatgtgtcaaattcactacc
ggcaattgttttccccaggaacccctcggtgagccaccgatattgggtaaaaggtgcacc
cgctattggcagcactgtggttttagtctccagctacttaactatccggatgccgtaaat
cagccggattttccacgcatctttttcaatccgggggatctttattaccatgaaaccatc
tatcattttggtgttcaggaatcgtggaaatgctgtgccgatccggaggaattggaagcc
ctgggcgaagaaccactgcggaaatcgaaagtttga

DBGET integrated database retrieval system