KEGG   Drosophila erecta: Dere_GG19512Help
Entry
Dere_GG19512      CDS       T01060                                 

Definition
GG19512 gene product from transcript GG19512-RA
Orthology
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dere_GG19512
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1256 aa AA seqDB search
MSSPDDRIPIHDLPSEAGSDERLLHITPATLTLDFKPHPAVDIDQQIMELKKSQELQKQR
LINSFQEQSKQMELEHKLQLEHKYQFAVNSHGAFQELRNESMVTAAAAAAAAVAQEQHRQ
QLHQHQQQQQQHQQQQQQQQQHQQQQQQQARGRDGMKLKQNCSANASPEVKQILNCFILS
RKSQAAASNGTTTTSPYRNRGVVKSSSGESLPAGTVTSAHPYKIPQPPPSLLKYESDFPL
RKTASEPNLLKIRLKQSVIERKARIGGPAGARRHERLLQAAQRRQQKNSVLTNCNSTPDS
GPNSPPSAAALAVGVVGSRGSPTSAPIQEENEEGSQYQPGQRSSINDLPLFSSPSLPNIS
LGRPHLPNSAQAHAQVNAQVAAQAQAQAQAQAQAQAHAMFAALAAAQGGCGQPGYYNPLG
MAFVGRQPAPLAMIPATGIAPQQPSPVVRSASATSTSSSQASLVGDVAPPQAHAASTILP
SSSSYMQQLGSVAGSGVNLHAAAVAAAAAAAAAAGSLPPTNSHGHGHGHGSHAHAHGHGH
GHGLYAGHQHNVPITDAQVAQVHLHKQGHRPLGRTQSAPLPLGHPMLTGAVQLNVVQTHY
ENSEAERQAYEHQVVNQKVRQTVLTRSGAAAAAAAAAGVSVVREAQLKEEDDDSAAEVMD
LTDKKKPPKTVLTSTIATSTSQNLPEALAAAAAAAAYRAPHTTSSNSASATKSGIKLRDQ
EYLQQQREQLLLLQQEEELAKSIMRPLSRTLSSPLVPLGPHGLSQIPDTGQQPAPIATSS
SADHIPPVNLSLPHRQHRQLMSTIYVSQLRNHQTSASGSPPHKVTTGLAYDPLMLKHSCI
CGDNAQHPEHSGRLQSVWARLNETDLVKRCDRLRARKATQEELQSVHTEAHAMLFGSNQC
QLSRPKLENTLSASFVRLSCGGLGVDLDTTWNEHHTATAARMAAGCVIDLALKTAKGDLR
NGFAVVRPPGHHAEANLAMGFCFFNSIAIAAKLLRQRMPEVRRILIVDWDVHHGNGTQQA
FYQSPDILYLSIHRHDDGNFFPGTGGPTECGSGAGLGFNVNISWSGALNPPLGDAEYIAA
FRTVVMPIARSFNPDIVLVSSGFDAATGHPAPLGGYHVSPACFGFMTRELLQLANGKVVL
ALEGGYDLAAICDSAQECVRALLGDPAAPIAKAELERPPCQNAINTLQKTIAIQQTHWPC
VRMLEHTVGLSALETLKVEHDESETINAMAGLSMQSMHRTLSRDDSEEPMDQDETK
NT seq 3771 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtcccgacgatagaataccaatacacgatctgccatcagaagccggaagcgat
gagcgattgctgcacataacgccggccactctgacattggacttcaagccccatcccgcc
gtggatatcgatcagcagatcatggagctcaagaagagccaggagctgcagaagcagcgg
cttatcaactcgtttcaggagcaatcgaagcaaatggaattggagcataaactccaactg
gagcacaagtatcaatttgcggtgaattcacatggcgctttccaggaattgcgaaacgag
agcatggtgacagccgccgctgctgcggccgctgcggtggctcaggagcagcatcgccag
cagttgcatcaacatcagcagcagcagcagcaacaccagcagcagcagcagcagcagcaa
cagcatcagcagcagcagcagcaacaggcgcggggcagggatggcatgaaactcaagcag
aactgtagtgccaatgccagtcccgaggtcaaacagattctcaactgcttcatcttgagc
aggaagtcgcaggcggcggcttcgaatggcacaacgacaacgtcgccctacaggaatcgc
ggcgtggtgaagagctcctcgggcgaatccctcccagctggaaccgtgaccagtgcgcat
ccgtacaaaatacctcagccgcccccctcactgctcaaatatgaatctgattttccgctg
aggaagacagcatccgaacccaacctgctgaagatccggctgaagcagagcgtcatcgag
cgcaaggcccgcatcggaggaccggcgggagcccggcgccacgaacgactcctccaggcg
gcgcagcgcaggcagcaaaagaactcggttctcacaaactgcaacagcacaccggactct
ggacccaactcgccgccctcggcagccgcgttggcggtgggcgtggtcggaagccgtgga
tccccgacaagtgcacccatccaggaggagaacgaggaggggagccaatatcagccgggc
cagaggagcagcatcaacgatttgccactgttcagctcgccctcgctgccgaatatttcg
ctcgggcgaccgcatttacccaactcggcgcaggcgcatgcccaggtgaatgcccaggtg
gctgcccaagctcaggctcaggcacaggcccaggcacaggctcaggcgcatgccatgttc
gcggcactggctgccgcccagggaggctgcggacagccgggctactacaatccattgggc
atggcattcgttggccgccaaccagcaccgctggccatgattccggccacggggatagct
ccacagcaaccgtcgccggtggtgcgcagtgcatcggccacctcgacatcgtcgtcgcag
gcctccctggtgggcgatgtggcgccaccgcaggcccatgccgcctccaccattctgccc
tcgtcgtcgtcctacatgcagcaattgggcagcgtggccggttcgggggttaatctccac
gccgccgccgtggctgcagcggcagcagcagcagccgccgccggatcattgccacctacc
aatagccatggtcacggacacggacacggctcccacgcacatgcccatgggcacggacat
ggtcatggcctctacgcaggccatcagcacaatgtgcccatcacggacgcccaggtggcg
caggtgcatctccacaaacagggccaccggccgctgggacgaacgcagtcggcgccactg
ccccttggtcatccgatgctaaccggagctgtgcagttgaatgtggtccaaacgcactat
gagaatagtgaggcggagcgccaggcgtacgagcatcaggtggtgaaccagaaagtccgt
cagactgtcctgactcgcagcggagctgctgcagcagccgctgctgccgccggcgtgagc
gtggtgcgtgaggcacagctgaaggaggaggacgatgactcggccgccgaggtaatggac
ctcacagacaagaaaaaaccgccgaagacggtgctgaccagcacgatagccaccagtacg
tcccagaatctgcccgaagctttagcggcggcggcggcagcagccgcctaccgtgccccg
cacaccacgtccagtaactccgcctccgccacaaagtccggcattaagctgcgggaccag
gagtatctgcaacagcagcgggagcagctattgctgcttcagcaggaggaagaactggcg
aagagcataatgcgtccgctctcgcgaacgcttagcagtccgctggtgccgctggggccg
catggtcttagccagattcccgacactggacagcagccggcaccgatagccacatcctcg
tcggccgatcatataccgcccgtgaacctctcgctgccgcatcgccagcaccgccagcta
atgagcaccatatacgtcagccaattgcgtaaccaccagacatcggcgagtggttcaccg
ccgcacaaggtcaccaccggtttggcctacgatccgcttatgctgaagcactcgtgtatt
tgcggagacaatgcccagcatccggagcacagtggtcgactgcagagcgtttgggcacgg
ctaaatgaaacggatctggtgaagcgttgcgatcgcctgcgcgctcgcaaggcgacacag
gaggagctgcagagtgtgcacacagaagcgcatgctatgctcttcggatcgaatcagtgc
cagctgagcaggcccaagttggagaacacattgtcggccagcttcgttcgcctatcgtgc
ggtggtttgggtgtggatctggataccacgtggaatgagcaccatacggcaaccgctgcc
cgaatggccgctggttgtgttatcgatttggcgctgaaaacggccaagggtgacctgcgg
aatggctttgccgttgtacggccgccgggccatcatgcggaggccaatctggccatgggc
ttctgtttcttcaattcgatcgccattgcggccaagctgctccgtcagcggatgcccgaa
gtgcggcgcatcctcatcgtcgattgggatgtgcatcacggcaatggcacacagcaagca
ttctaccaaagtcccgacattctatatctttccatacatcgacacgatgacggtaacttc
tttcccggcacaggtggacccacagagtgcggctccggtgctggtctcggctttaacgtg
aacatctcatggtctggggcacttaatccgccactgggcgacgccgagtatatcgctgca
ttccgtaccgttgtgatgcccatcgcgcggagctttaatccggacattgtgctggtatcc
tccggcttcgatgcggccaccggccatccggcaccgctgggtggctaccatgtctctccg
gcctgctttgggttcatgacccgcgaactacttcagttggccaatggcaaagtggtgctg
gcccttgagggtggctacgatctggccgccatctgtgattccgcccaggagtgtgtgcgg
gcgctgctcggcgatcccgctgctcccatagctaaggccgagctggagcgtccgccctgc
cagaacgccatcaatacgctgcagaagacgatagccattcagcaaacgcactggccctgc
gtgagaatgctggagcacacggtgggcttgtctgcgctggagacgctcaaggtggagcac
gacgagtccgagacgatcaacgccatggctggcctctcgatgcagtcgatgcacagaaca
ctatcccgcgatgattccgaggagccgatggaccaggacgaaaccaaatag

DBGET integrated database retrieval system