KEGG   Drosophila erecta: Dere_GG19526Help
Entry
Dere_GG19526      CDS       T01060                                 

Definition
GG19526 gene product from transcript GG19526-RA
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
der  Drosophila erecta
Pathway
Protein processing in endoplasmic reticulum
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:der00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dere_GG19526
Enzymes [BR:der01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     Dere_GG19526
Protein kinases [BR:der01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   Dere_GG19526
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1179 aa AA seqDB search
MSTIEFETIGSRLQSLEAKLQAQNESHDQIVLSGGRGPGVSGSVPSARVPPLATSAATSA
AHAPPLGAGSVPGSGISIAQRPAPPVPHATPFGRASASTSSSASAFASAAPATGSFGGTY
TPPTTRVSRVTPTLPMLSSGPGGGVNRTRPVILPLPTPPHPPVSETDKKLKIIMEQTGKL
NINGRQYPTDINDLKHLGDLGNGTSGNVVKMMHLSSNTIIAVKQMRRTGNAEENKRILMD
LDVVLKSHDCKYIVKCLGCFVRDPDVWICMELMSMCFDKLLKLSKKPVPEQILGKVTVAT
VNALSYLKDKHGVIHRDVKPSNILIDERGNIKLCDFGISGRLVDSKANTRSAGCAAYMAP
ERIDPKKPKYDIRADVWSMGITLVELATARSPYEGCNTDFEVLTKVLDSEPPCLPYGEGY
NFSQQFRDFVIKCLTKNHQDRPKYPELLAQPFIRTYEIAKVDVPNWFQSIKDNRLRANGD
PTLQRATATGSVVGSGAGSLAGSGSAGGAVKYGRATPYAGQSPTSSQKTIKPTQIPSYQQ
QQSQYFMQSATQLPQTTTTTPTATTNCFGGSGNGNGRGNGSGGSGSGNGSGSSSSASPLS
PPSAGIGDLNRLYRKSPFMQRKLSNGSHHPHYKYNDESPKKESMFSSIGQSILRNLTTSP
FSQKKHNSAAATATSIPLPHNNQTLITDAAAAAAGAPTPPNIAAAALATTPTTTPTWRLP
AENPQAYDSCDSSSNATTTTLNLGLSSPSPSLPRKQFPTESPTPTLQLTSQQPQPQRLQP
GNQSPIVLQRFYHQQNQLREKEAAERYQQQRQQPPVGVTSTNPFHSNYVPPPPSTHSTSS
QSSTQSTCSQIAVNPASISPSSGSGTANVAGIGIGLGSGLGAAGHFGAGGNGEQLQYQPL
PIAAEAAGTSPTLQPRSPEQQSDCGASGSMVASKLSKLYARRQLLGQSSSSGASNSSLDG
CSREQHDAGWFNTLAGAMKRQFATYVKTQLNSTATSPVASSMDRDQELVHPQPPAYRSVV
NNGSVGKSYYYRTLSAASSSSNTSQSTSPTTEPLPGGGTSSFLRRYASSGPGMGGGGGSI
STPPSPHILAGLDRRHRSPDPPPRYNRGQSPLLLRKNLLELSGQPPGSPLLHRRYVSASP
PLPPPRRGSESVPGSPQHFRTRIHYTPEPQRRIYRTIDQ
NT seq 3540 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccattgagttcgaaacgatcggcagtcggctgcaatccttggaggcgaagctt
caggcgcagaatgagtcccacgaccagatcgtcctttccggtgggcgcggaccaggcgtt
tccggttccgttccgtctgcccgcgttccgccgctggcgacatccgcagccacatccgcc
gcccacgcaccgcccctgggcgcaggttccgttcccggatcgggaatcagcatagcccag
cggccggcacccccagttcctcatgcgacgcccttcggcagggccagcgcctcgacgtca
tcatccgcatccgcatttgcatccgcagcaccagcgacgggctccttcggtggaacatac
accccgcccacaactagagtgtcgcgagtcacgcccacactgcccatgctatctagcggc
cccggtggcggagtgaatcggacgcggccggtgatacttccgttgcccacgccgccgcat
ccaccggtgtcggaaacggacaagaagctgaagatcatcatggagcagaccggcaagctg
aacatcaacgggcggcagtatccgacggacatcaatgacctcaagcatctgggcgacctg
ggcaacgggaccagcggcaatgtggtgaagatgatgcacctgtccagcaacacgatcatc
gccgtgaagcagatgcggcgcactggcaacgcggaggagaacaagcgcatcctgatggat
ctggacgttgtgctcaagtcgcatgactgcaagtacattgtcaagtgcctcggctgcttt
gttcgcgatccggatgtgtggatctgcatggagctgatgtccatgtgctttgataagctg
ctcaagctctccaagaagccggtgccggaacagatcctgggcaaggtcactgtggcgacg
gtcaacgcgttgtcctatctgaaggacaagcacggggtcatccatcgagatgtgaagccc
tcgaacattctgatcgacgagcgcggtaacatcaagctctgtgatttcgggatcagcggt
cgcctggtggactccaaggccaacactcgatccgccggctgtgcagcttatatggcgccg
gagcgtatcgaccccaaaaaaccaaagtacgacattcgcgcagatgtgtggtccatgggc
atcacgctggtggagctggccaccgcgcgatctccgtacgagggatgcaacacggacttc
gaggtgctcaccaaggtgctggactcggagccgccgtgtttgccatacggcgagggctac
aactttagtcagcagttccgcgatttcgtcatcaagtgcctcacaaagaaccatcaggat
cgacccaagtacccggagcttctggcccagcccttcatccggacttatgaaatagccaaa
gtagatgtgcccaattggtttcagagcatcaaggataaccggctgcgtgccaatggcgat
ccaacgctccagagggcgacggcgactggaagtgtagtcggttctggtgccggatctctc
gcaggatcaggatccgcgggtggagctgtaaaatatggtagggcgacgccgtatgcgggc
cagagtcccacaagttcgcagaagacaataaaacccactcagataccgagttaccagcag
cagcagtcgcagtatttcatgcaatcagccacacaactacctcaaacaacaaccacaaca
ccgacggcaacgacaaactgtttcggcggcagcggaaacggcaatggacgaggaaatggc
agcggcggaagtggaagtggaaatggtagcgggagcagcagcagtgccagccccctatcg
ccaccaagcgccggaatcggcgatctaaaccggctttatcgcaaatcgccgttcatgcag
cgaaaactgagcaacggatcccatcatccgcactacaaatacaacgacgagagccccaag
aaggagtccatgttcagtagcatcggccaatcgattctacgcaatctgaccacatcgccc
ttcagccaaaagaaacacaattcagcagcagcgactgcgacatcaataccactgccgcac
aacaaccaaacattgatcacggatgcagcagcagcagcagcaggagcaccaacaccgcca
aatattgcagctgcggcgctcgcgacaacgccaacgaccacgcccacttggcgcctgcca
gcggaaaatccccaagcctacgacagctgtgatagtagtagtaatgcgaccacgacgacc
ttgaatttgggcctctcctcaccctccccctcgttgccgcgcaagcaattccccacagaa
tcgccgacgccgactctgcagctcacgagtcagcagccacaaccacagcgattgcagccg
ggcaaccagagccccatagtgctgcagcgcttctaccaccagcagaaccagctgcgcgag
aaggaggcggcggagcggtatcagcagcagcggcagcagccgcccgtgggagtgaccagc
acgaatccgtttcacagcaactatgtgccgccgccgccatcaacgcactccacctctagt
cagtcttccacgcagtcgacatgttcgcaaatcgccgtcaatcccgccagcatatcccca
tcgtctggctctggaacggcaaatgtagcgggaataggaataggattgggatcaggattg
ggggcagctggtcactttggagcgggcggcaatggcgagcagttgcagtaccagccgctg
cccatcgccgccgaggcagcgggcacgagtcccacgctgcagcccaggtcaccggaacag
cagtcggattgtggagcaagtggcagcatggtggccagcaagctgagcaagctgtacgca
cgccgacagcttttgggccagagctccagcagcggagcgagcaacagcagcctggatggc
tgcagtcgggagcaacacgatgccggctggttcaacacacttgccggtgccatgaagcga
cagtttgccacctatgttaaaacccaattgaattccacagccacgtcgccggtggcgtcc
agcatggatcgcgatcaggagctggtgcatccgcagccgccggcgtacaggagcgtcgtg
aataacggcagcgttggcaagtcctactactatcgcaccttgtcggcggccagcagcagt
agtaataccagccagagcacctcgcccacaacggagccactgcccggaggcggcaccagt
agcttcctgcgtcgctacgccagcagcgggccgggaatgggcggcggtggcggtagcatc
agcacgccgcccagtccgcatatcttggcaggattggatcgcagacatcggagtccagat
ccgccgccacgctacaatcgcggacagtcgccgctgttgctgcggaagaatctgctggag
ctgagtggtcagccgcccggctctccgctgctgcatcgcagatacgtttcggcctcgccg
ccgctaccgccaccgcgacgaggctctgaaagcgtgccgggatcaccgcaacatttccgc
actcgcatccactatacacccgagccccagagacgcatctaccgtacgatagatcaatga

DBGET integrated database retrieval system