KEGG   Drosophila erecta: Dere_GG19533Help
Entry
Dere_GG19533      CDS       T01060                                 

Definition
GG19533 gene product from transcript GG19533-RA
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
der  Drosophila erecta
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:der01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:der01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 407 aa AA seqDB search
MSPNIIGSTFILAETAIADGNNNKMAATPATSAAPPAAATQKVAKKAEAKTAENKPYEME
IVWRNVGLFIILHSMALYGLYLVFAESAYWELLPVYATMFFGGLGITAGVHRLWSHKAYK
AKLPLRIFLMLCQSLAFQNSIWEWTRDHRVHHKFTDTHADPHNSRRGFFFAHMGWLMCKK
HPDVTSKGKQISMEDIEQDPVVMFQKKMYFVVMPICCFVVPMIFPYYVMGSSLRVCFFTC
SMLRFCLSLHFTWLVNSAAHFYGMKPYDVNVSAMNNKLVSTLTIGEGWHNYHHVFPWDYK
AAELGTYSFNWTTAFIDVMAKIGQAYDLKFVSQEMVYKRVLRTGDGSHIAALLDANNNSA
IPTTELVAHLDHEKEEHAIWGWDDKDISEEDRKGANVVNKESDCKLD
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcccaacataataggcagtacctttatattggccgagacggccattgccgatggc
aacaacaacaagatggccgccacaccagccacttccgccgcccctccagcagccgccacc
cagaaggtggccaagaaggcggaggccaagacggccgagaacaagccctacgaaatggag
atcgtgtggcgcaacgtgggactcttcatcatcctccactcgatggccctgtacggtctg
tacctggtgttcgccgagagtgcctactgggaactcttgccagtttatgccaccatgttc
tttggcggtctgggcatcacagccggagtgcatcgtctgtggtcccacaaggcctacaag
gccaagctgccactccgcatcttcctcatgctgtgccagtccctggccttccagaacagc
atctgggagtggacccgtgaccaccgtgtgcaccacaagttcaccgacacacacgccgat
ccccacaactcccgacgcggcttcttcttcgcccacatgggctggctgatgtgcaagaag
caccccgatgtgaccagcaagggcaagcagatctccatggaggacattgagcaggatccc
gtcgtcatgttccaaaagaaaatgtacttcgtggtgatgcccatctgctgcttcgtcgtg
cccatgatcttcccctactacgtgatgggcagctcgctgcgcgtctgcttcttcacctgc
tccatgctgcgcttctgcctgtcgctgcacttcacctggctggtgaacagcgccgcccac
ttctacggcatgaagccctacgatgtcaacgtgagcgccatgaacaacaagctggtgtcc
accctgaccatcggcgagggatggcacaactaccaccacgtgttcccctgggactacaag
gcagccgagctgggcacctacagcttcaactggacgacggcctttatcgatgtgatggct
aagatcggacaagcctatgacctgaagttcgtctcccaggagatggtctacaagagagtt
cttcgcactggcgatggctctcacattgccgccctgctggatgccaacaacaacagtgcc
atcccgaccaccgagctggtggcccacctggatcacgagaaggaggagcacgccatttgg
ggatgggacgacaaggacatcagcgaggaggatcgcaagggagccaatgtggtcaacaag
gagtccgattgcaagctggattag

DBGET integrated database retrieval system