KEGG   Drosophila erecta: Dere_GG19541Help
Entry
Dere_GG19541      CDS       T01060                                 

Definition
GG19541 gene product from transcript GG19541-RA
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
der  Drosophila erecta
Pathway
Purine metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dere_GG19541
Enzymes [BR:der01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     Dere_GG19541
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     Dere_GG19541
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 428 aa AA seqDB search
MSTTTTSIEGYKLGKVIIEGKTKQVYDLPEQPGLCLLLSKDRITAGDGVKAHDLAGKAEI
SNTTNGQVFRLLNEAGIRTAYVKHCGAKAFIARKCQMIPIEWVTRRLATGSFLKRNVGVP
EGYRFSPPKQETFFKDDANHDPQWSEEQIVSAKFELNGLVIGQDEVDIMRRTTLLVFEIL
ERAWQTKNCALIDMKVEFGVCDDGNIVLADIIDSDSWRLWPAGDKRLMVDKQVYRNLASV
TASDLDTVKRNFIWVAEQLADIVPKKDHLVVVLMGSASDTSHSEKIATSCRSLGLNVELR
VSSAHKGPEETLRIVREYESVMSNLIFVAVAGRSNGLGPVVSGSTNYPVINCPPVKSDNM
QVDVWSSLNLPSGLGCATVLYPEAAALHAATILGLGNFMVWSKLRVKALNNFITLKKADK
ELRGVRNA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccacaaccacatccatcgagggctataagctcggaaaggtcatcatcgagggc
aagacgaagcaggtgtacgatctgccggagcagccaggactgtgcctgctcctcagcaag
gatcgcatcaccgcaggagatggtgtcaaggcgcacgacctggccggcaaggcagagatc
tccaataccaccaacggccaggttttcagactgctcaacgaggctggcattcgcaccgcc
tatgtgaagcactgcggcgccaaggcgttcatcgcccgcaaatgccagatgatacccatt
gagtgggtgacccgccgcctggccaccggatcgttcctcaagcgcaatgtcggcgtgccc
gagggctacaggttctcgccgcccaagcaggagacgttcttcaaggacgacgccaatcac
gatccccagtggagcgaggagcagatagtctccgccaagtttgagctgaatggcctggtg
atcggccaagatgaggtggacattatgcgtaggaccacactgctggtctttgagatactc
gagcgggcgtggcagaccaagaactgcgcgctcatcgacatgaaagtggagttcggtgtc
tgcgacgatggcaacatcgtgctggccgacatcattgattccgattcgtggcgcctgtgg
ccagccggtgacaagcgcttgatggtggacaagcaggtgtatcgcaatctggcatcggtg
acggccagcgacttggataccgtgaagaggaacttcatttgggtggccgaacagctggct
gatattgtgccaaagaaggaccatctggttgtggtcctaatgggcagtgcctccgataca
tcacacagcgagaagatagccaccagctgtcgatctctcggcctgaatgtggagctccgt
gtgagttccgcccacaagggaccggaggaaacgctgcgcattgtccgcgaatacgaatcg
gtgatgagcaatctgatattcgtcgccgtcgctgggcgatccaatggactgggtccagtc
gtttccggcagcaccaactatccggtgatcaattgtcctcccgtcaagtcggacaacatg
caggtggacgtctggtccagcttgaatctgccatccggcttgggctgtgccaccgtcctc
tatccggaggcagctgctctccatgcggccaccattttggggctgggcaacttcatggtc
tggtccaagttgcgtgtcaaggcgctcaacaacttcatcaccctcaagaaggccgacaag
gagttgcgcggcgtgcggaatgcttag

DBGET integrated database retrieval system