KEGG   Drosophila erecta: Dere_GG19564Help
Entry
Dere_GG19564      CDS       T01060                                 

Definition
GG19564 gene product from transcript GG19564-RA
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
der  Drosophila erecta
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:der00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    Dere_GG19564
Enzymes [BR:der01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dere_GG19564
Peptidases [BR:der01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dere_GG19564
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1136 aa AA seqDB search
MEIETDQSIEAMDTQDTQEVEILTSDLQQQQQQQNPQQQQQNSPPQLPKFKNLIQPQLHA
VGAVTQLPSENGNVPPQQLLADSSSTSFGDSEAMGIDDESKEDQFRSETTFSFTVENVVQ
LKSQRLSPPVYVRMLPWRIMVIPNDRALGFFLQCNGENDSPTWSCNAIAELRLKCHKPDA
QPFSRARIKHLFYSKENDYGYSNFITWQELQDADKSYVHNNSITLEVHVIADAPHGVLWD
SKKHTGYVGLKNQGATCYMNSLLQTLYFTNSLRLSVYRIPTEADDSTKSVGLSLQRVFHE
LQFGDRPVGTKKLTKSFGWETLDSFMQHDVQEFLRVLLDKLESKMKGTTLEGTIPGLFEG
KMSSYIKCKNVDYNSTRYETFYDIQLNIKDKKNIYESFQDYVAPETLEGDNKYDAGVHGL
QEASKGVIFTSFPPVLHLHLMRFQYDPVTDSSIKYNDRFEFYEQINLDRYLAESEKTSAD
YVLHAVLVHSGDNHGGHYVVFINPKADGRWFKFDDDVVSSCRKQEAIEQNYGGMDDEISF
HAKCSNAYMLVYIRQSELERVLGDIPENEISSDLVERLDLEKRIEMARRKERSEANLYVS
VHVILEEYFEDQHKRRLFDLEKAHPRIFRIKQNQTVDELVDMFVKGFGVSRERMRMWNMC
TAQTQKFLHFDFVAEASRAIEQIPTSQKPWVIWLELAGSDVPGPLPSFNPKTEALLFLKY
YDARNKRLNYIGCTQQPHTRRLIDLVPEVNRKLGFDADTELTIYDEYADKKLANLNEPIE
SVLFIPQDHLQGHILIFERENVDAKLDLPTVEDYFLDLVYRIEIIFSDKCNPNEPDFTLE
LSNRYNYDQLTNAVAERLNTDPQKLQFFMCINNYKETAGNAVPYTFKGTIKDLVSYTKQS
TPKRIFYQRLSLSIHELDNKKQFKCVWVSSDLKDEKELVLYPNKNDTVKGLLEEAAKKIT
FAENSRRKLRLMKVSNHKIVAICKDDIPLDTLLKTNDSITTTQGAQKTYRIEEVPAEEMQ
LAENEFLIPVAHFSKDLYNSFGVPFLAKTRHGEPYGALKQRIQRRLNVPDKEWENYKFSV
ISMGHNSDVNDNTPVDLEVYRSWTSGQLPFFGLDHINKSRKRSSLNFSEKAIKIYN
NT seq 3411 nt NT seq  +upstreamnt  +downstreamnt
atggaaattgaaacagatcagtctattgaagcaatggacacccaggacacccaagaggtc
gagatcctcaccagtgatctccagcagcagcaacaacaacagaatccgcagcagcagcaa
cagaattcgccgcctcaattgcccaaattcaagaatcttatccagccacaattgcacgcc
gttggtgcagtcacccaattgcccagcgagaacggcaatgtgccgccacagcaactactg
gcggatagcagctccacttcattcggcgactctgaggccatgggtatagacgatgagtcc
aaggaggaccagttccgctcggagaccacattctcattcaccgtcgagaatgtggttcaa
ttgaaatcgcagagactgtcgccgccagtgtatgtccgcatgttgccatggcgaattatg
gtcatacccaatgatcgcgcgctgggcttcttcctgcagtgcaatggggagaatgattcg
cccacctggtcgtgcaatgccattgccgagctgcgtttgaagtgccacaagcccgatgca
cagccattcagccgtgcccgtattaagcatttgttctactccaaggagaacgactatggc
tactcgaattttatcacctggcaggagctgcaggatgccgacaagagctatgtgcacaac
aacagcatcaccctggaggttcacgtgattgcggatgcaccgcatggcgttttgtgggac
tcgaagaagcacacaggctatgtgggcctcaaaaatcagggcgccacctgctatatgaac
tcgctgctgcagacattgtacttcaccaattccctaagactgtctgtgtatcgcataccc
acggaggctgacgatagtaccaaatcagttggactatcgctgcagcgtgtgttccatgag
ctgcagtttggtgaccgtcccgtgggcaccaagaagctaaccaagtcctttggctgggag
acactcgattcgttcatgcagcacgatgtccaggagttcctccgcgtgctgctcgacaag
ctcgagtcgaagatgaagggcaccaccctggagggcaccattccgggtctgttcgagggc
aaaatgtcttcgtacattaaatgcaagaacgtcgactacaacagcacacgctacgagacg
ttctacgacatccagctgaacatcaaggataagaagaacatctacgagtccttccaggat
tacgtagcccccgagacgctggagggtgacaacaaatacgatgctggtgtgcatggcttg
caggaagccagcaagggcgtcatcttcacttcattcccacccgttttgcatctgcatctg
atgcgcttccagtacgatcccgtcacggatagctcgatcaagtacaacgatcgcttcgag
ttctacgaacagatcaatctggatcgctatctggccgagagcgagaagacctcggcggac
tacgttctgcacgccgtgttggtgcactctggcgataaccatggcgggcactatgtggtc
ttcattaatccaaaggctgacggacgttggtttaagttcgacgacgatgtggtctccagt
tgtcgcaagcaggaggcgatcgaacagaattacggcggtatggacgacgagatctcgttc
catgccaagtgcagcaatgcctatatgctggtctacatccgccagtcggagttggagcga
gtcctcggcgacataccagagaacgagatctcaagcgacctggtcgagcgcctcgacttg
gagaagcgcatcgaaatggcgcgccgcaaggagcgcagcgaggccaacctatatgtgtcc
gtgcacgtgatcctcgaggagtacttcgaggaccagcacaagcgtcgtctcttcgatctg
gagaaggcccatccgcgcatcttccgcatcaagcaaaatcagactgtcgacgagctggtg
gacatgtttgtcaagggtttcggagtgtcgcgcgaacgcatgcgcatgtggaacatgtgc
accgcccagacgcagaagttcttgcattttgatttcgtggcggaggcgtcgcgagccatc
gaacagataccaacgtcacagaaaccgtgggtcatctggctggagctggccggctccgat
gttcctggtcccctgccgtcctttaatcccaagaccgaagccctgctgtttctcaagtac
tatgatgcgcgtaacaagcgcctaaactacattggatgcacccaacagccgcacacccgc
cgcctcattgatctggtgccggaggttaaccggaaactgggcttcgatgcggacaccgag
ctgaccatctacgatgagtacgccgacaagaagctggccaacctgaacgagcccatcgag
agtgtgctgttcataccgcaggatcacctgcaaggccacatcctaatcttcgaacgcgaa
aatgtcgacgccaaactcgacctgcccacggtagaggactacttccttgatctggtctac
cgcatcgagatcatcttcagcgacaaatgcaaccccaatgaaccggacttcacgctggaa
ctgtccaatcgctataactacgatcaactcaccaatgcggtggccgagcgcttgaatacc
gatccacagaagctgcagttctttatgtgcatcaacaactacaaggagacggcgggcaac
gcagtgccctacacttttaagggtaccatcaaggatctggtgtcctacaccaaacagagc
acacccaagcgtatcttctaccagcgcctctcgctcagcatccacgagctggacaacaag
aagcagttcaagtgcgtctgggtgagcagcgacctcaaggacgagaaggagctggtgctg
tatcccaacaagaacgatacggtgaaaggactgctggaggaggcggccaagaaaatcacg
tttgcggagaacagccgtcgcaagctgcgcctgatgaaggttagcaaccataaaatcgtg
gcgatatgcaaggacgacatcccgttggatacgctgctaaagaccaacgactccatcacg
accacacagggcgctcaaaagacttatcgcatcgaggaggtgccagcggaggagatgcag
ctggcagagaacgagttcctcatcccagtggcacatttcagcaaggatctgtacaactcg
ttcggcgtacccttcctagccaagacgcgtcacggcgagccgtatggagcgctaaagcag
cgcatccagcgacgtctgaatgtgccggacaaggagtgggaaaactataaattctccgtg
atctccatgggccacaattcggatgtgaacgacaacacgcccgtcgacctggaggtgtat
cgctcgtggaccagcggccagttgcccttctttgggttggatcacatcaacaagtcgcgc
aagcgcagctcgcttaacttttccgagaaggccatcaagatatacaactag

DBGET integrated database retrieval system