KEGG   Drosophila erecta: Dere_GG19579Help
Entry
Dere_GG19579      CDS       T01060                                 

Definition
GG19579 gene product from transcript GG19579-RA
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dere_GG19579
Peptidases [BR:der01002]
 Cysteine Peptidases
  Family C86
   Dere_GG19579
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 216 aa AA seqDB search
MESPSGNTLGDDCGNANGNGNGNGNTTMMPHGIYHERQTRHLCGLHALNNLFQGPDSFSK
TEMDDYCTTLTPRNWLNPHRSWIGWGNYDVNVIMYALQQRKCEAVWFDRRRDPHCLNLSA
IFGFILNVPAQMSLGYYIPLPFQMRHWLALRRLNGSYYNLDSKLREPKCLGTEHEFLEFL
ATQLQMDHELFVVLNEEADSKDSKTQQRWLLPQFRD
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggaatctcccagtgggaatactctgggggatgactgtggcaacgcgaatgggaatgga
aatgggaacgggaacaccacaatgatgccgcatggaatctaccatgagcggcagacacgc
cacctttgcggcctccacgccctgaacaacctgttccagggccccgactcgttctccaaa
acggagatggacgactactgcaccacactgaccccgcgcaactggctgaatccgcatcga
tcgtggatcggttggggcaactacgacgtgaatgtgatcatgtacgccctgcagcagcgg
aaatgtgaggcggtatggttcgaccgccgccgggatccacactgcctcaatctgagcgcc
attttcggcttcattcttaatgtgccggcccagatgagcctgggctactacatcccactg
cccttccagatgcgccactggctggcactgcgtcgcttgaacggcagctactacaacctg
gactctaagctgcgggagccaaagtgcttgggcaccgagcatgagttcctcgagtttctg
gccacccaactgcagatggaccacgagcttttcgtggtgctgaacgaggaagcggactca
aaggactccaagacccagcaacgttggctgctgccgcagttcagggattaa

DBGET integrated database retrieval system