KEGG   Drosophila erecta: Dere_GG19681Help
Entry
Dere_GG19681      CDS       T01060                                 

Definition
GG19681 gene product from transcript GG19681-RA
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
der  Drosophila erecta
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dere_GG19681
Enzymes [BR:der01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     Dere_GG19681
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 655 aa AA seqDB search
MLKMPLQLSSQVGIWPTRSRRLHHQLAYHRQDQEQQQKQKQTGVHQGRSPTFMPVMLLLL
MATLLTRPLSAFSNRLSDTKLHEIYLDDKEIKLSWMVDWYKQEVLFHLQNAFNEQHRWFY
LGFSKRGGLADADICFFENQNGFFNAVTDTYTSPDGRWVRRDYQQDCEVFKMDEFTLAFR
RKFDTCDPLDLRLHEGTMYVVWARGETELALEDHQFALPNVTAPHEAGVKMLQLLRADKI
LIPETELDHMEITLQEAPIPSQETTYWCHVQRLEGNLRRRHHIVQFEPLIRTPGIVHHME
VFHCEAGEHEEIPLYNGDCEQMPVRAKICSKVMVLWAMGAGTFTYPPEAGLPIGGPGFNP
FVRLEVHFNNPEKQSGLVDNSGFRIKMSKTLRQYDAAVMELGLEYTDKMAIPPGQTAFPL
SGYCVADCTRAALPATGIIIFGSQLHTHLRGVRVLTRHFRGEQELREVNRDDFYSNHFQE
MRTLHYKPRVLPGDALVTTCYYNTKDDQTAALGGFSISDEMCVNYIHYYPATKLEVCKSS
VSEETLENYFIYMKRTEHQHGVHLNGARSSNYRSIEWTQPRIDQLYTMYMQEPLSMQCNR
SDGTRFEGRDSWEGVAATPVQIRIPIHRKLCPNYNPLWLKPLEKGECDLLGECIY
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaatgccgctgcagctgagcagtcaggttggcatttggccaacccgatcccgg
cgactccaccaccaactggcttatcatcgtcaggaccaagagcagcagcagaaacaaaag
caaactggagtgcaccaaggacgttcgccgacattcatgccagtgatgctgctcctcctg
atggccacacttctcacgcgcccactgagcgccttctccaaccgattatccgacacaaag
ctgcacgagatctacctggacgacaaggagattaagctgagctggatggtggactggtac
aagcaggaggtgctcttccacctgcagaatgctttcaacgagcagcaccgctggttctat
ctgggattctcgaagcgcggcggcttggcggatgcggatatttgcttcttcgagaatcag
aatgggttcttcaacgcggtaaccgatacgtacaccagtccggatgggcggtgggtgagg
cgggactaccagcaggactgcgaggtcttcaagatggatgagttcacgctggcctttagg
cgcaagttcgacacctgcgaccctttggatctgcgactccatgagggcactatgtacgtg
gtttgggcccgtggtgaaacggagctggctctggaggatcaccagttcgcgctgcccaat
gtgactgctccgcatgaggcgggtgttaagatgctgcagctgctccgtgccgacaagata
ctgatacccgagaccgagctggatcacatggagatcaccctgcaggaggcgccgattccc
agccaggagaccacctactggtgtcacgttcagcgactggagggcaatctccggcgacgc
catcacatcgtccagttcgagccgctcatccggacgccgggcatcgtgcaccacatggaa
gtgttccactgcgaggccggcgagcacgaggagattcccctgtacaacggcgactgcgaa
cagatgccggtacgggccaagatctgctcgaaggtaatggtcctgtgggccatgggcgcc
ggcacctttacctatcctccggaagccggtctgccaatcggcggacccggcttcaatccg
ttcgttcgactggaggtacacttcaataatccggagaagcagagtggcttggtggacaac
tccggcttccgcatcaagatgtcaaagacactgcgtcagtatgacgccgccgtcatggaa
ctgggtctggagtacaccgacaaaatggccattccgcctggccaaaccgcgttcccgcta
agcggctactgtgtggcggactgcactcgcgccgctcttccggccacgggcatcatcatc
tttggctcccaactgcacacccatctacgtggcgtccgcgtcctcacccgccactttcgc
ggcgagcaggagctgcgcgaggtgaatcgcgatgacttctactcgaaccacttccaggag
atgcgcaccctgcactacaagccacgtgtcctgcccggcgacgctttggtgaccacttgc
tactacaataccaaggatgaccagaccgccgccctcggcggcttctccatcagcgacgag
atgtgcgtcaactacatccactactatccggccaccaagctggaggtctgcaagagttcc
gtttccgaggagacgctcgagaactactttatttacatgaagcgcacggagcatcagcac
ggcgtgcatctgaatggagccaggtcgtccaattaccggagcatcgagtggacccagccg
cggatcgatcagctctacaccatgtacatgcaggagccgctgagcatgcagtgcaacagg
tccgatggcacccgcttcgaggggcgggacagctgggagggcgtggcagcgacgcccgtc
caaatccgtatacccattcaccgcaaactgtgccccaactacaatccgctgtggctgaag
ccgttggagaagggcgagtgcgatttgctgggggagtgcatctattag

DBGET integrated database retrieval system