KEGG   Drosophila erecta: Dere_GG19681Help
Entry
Dere_GG19681      CDS       T01060                                 

Definition
GG19681 gene product from transcript GG19681-RA
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
der  Drosophila erecta
Pathway
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:der00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 655 aa AA seqDB search
MLKMPLQLSSQVGIWPTRSRRLHHQLAYHRQDQEQQQKQKQTGVHQGRSPTFMPVMLLLL
MATLLTRPLSAFSNRLSDTKLHEIYLDDKEIKLSWMVDWYKQEVLFHLQNAFNEQHRWFY
LGFSKRGGLADADICFFENQNGFFNAVTDTYTSPDGRWVRRDYQQDCEVFKMDEFTLAFR
RKFDTCDPLDLRLHEGTMYVVWARGETELALEDHQFALPNVTAPHEAGVKMLQLLRADKI
LIPETELDHMEITLQEAPIPSQETTYWCHVQRLEGNLRRRHHIVQFEPLIRTPGIVHHME
VFHCEAGEHEEIPLYNGDCEQMPVRAKICSKVMVLWAMGAGTFTYPPEAGLPIGGPGFNP
FVRLEVHFNNPEKQSGLVDNSGFRIKMSKTLRQYDAAVMELGLEYTDKMAIPPGQTAFPL
SGYCVADCTRAALPATGIIIFGSQLHTHLRGVRVLTRHFRGEQELREVNRDDFYSNHFQE
MRTLHYKPRVLPGDALVTTCYYNTKDDQTAALGGFSISDEMCVNYIHYYPATKLEVCKSS
VSEETLENYFIYMKRTEHQHGVHLNGARSSNYRSIEWTQPRIDQLYTMYMQEPLSMQCNR
SDGTRFEGRDSWEGVAATPVQIRIPIHRKLCPNYNPLWLKPLEKGECDLLGECIY
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaatgccgctgcagctgagcagtcaggttggcatttggccaacccgatcccgg
cgactccaccaccaactggcttatcatcgtcaggaccaagagcagcagcagaaacaaaag
caaactggagtgcaccaaggacgttcgccgacattcatgccagtgatgctgctcctcctg
atggccacacttctcacgcgcccactgagcgccttctccaaccgattatccgacacaaag
ctgcacgagatctacctggacgacaaggagattaagctgagctggatggtggactggtac
aagcaggaggtgctcttccacctgcagaatgctttcaacgagcagcaccgctggttctat
ctgggattctcgaagcgcggcggcttggcggatgcggatatttgcttcttcgagaatcag
aatgggttcttcaacgcggtaaccgatacgtacaccagtccggatgggcggtgggtgagg
cgggactaccagcaggactgcgaggtcttcaagatggatgagttcacgctggcctttagg
cgcaagttcgacacctgcgaccctttggatctgcgactccatgagggcactatgtacgtg
gtttgggcccgtggtgaaacggagctggctctggaggatcaccagttcgcgctgcccaat
gtgactgctccgcatgaggcgggtgttaagatgctgcagctgctccgtgccgacaagata
ctgatacccgagaccgagctggatcacatggagatcaccctgcaggaggcgccgattccc
agccaggagaccacctactggtgtcacgttcagcgactggagggcaatctccggcgacgc
catcacatcgtccagttcgagccgctcatccggacgccgggcatcgtgcaccacatggaa
gtgttccactgcgaggccggcgagcacgaggagattcccctgtacaacggcgactgcgaa
cagatgccggtacgggccaagatctgctcgaaggtaatggtcctgtgggccatgggcgcc
ggcacctttacctatcctccggaagccggtctgccaatcggcggacccggcttcaatccg
ttcgttcgactggaggtacacttcaataatccggagaagcagagtggcttggtggacaac
tccggcttccgcatcaagatgtcaaagacactgcgtcagtatgacgccgccgtcatggaa
ctgggtctggagtacaccgacaaaatggccattccgcctggccaaaccgcgttcccgcta
agcggctactgtgtggcggactgcactcgcgccgctcttccggccacgggcatcatcatc
tttggctcccaactgcacacccatctacgtggcgtccgcgtcctcacccgccactttcgc
ggcgagcaggagctgcgcgaggtgaatcgcgatgacttctactcgaaccacttccaggag
atgcgcaccctgcactacaagccacgtgtcctgcccggcgacgctttggtgaccacttgc
tactacaataccaaggatgaccagaccgccgccctcggcggcttctccatcagcgacgag
atgtgcgtcaactacatccactactatccggccaccaagctggaggtctgcaagagttcc
gtttccgaggagacgctcgagaactactttatttacatgaagcgcacggagcatcagcac
ggcgtgcatctgaatggagccaggtcgtccaattaccggagcatcgagtggacccagccg
cggatcgatcagctctacaccatgtacatgcaggagccgctgagcatgcagtgcaacagg
tccgatggcacccgcttcgaggggcgggacagctgggagggcgtggcagcgacgcccgtc
caaatccgtatacccattcaccgcaaactgtgccccaactacaatccgctgtggctgaag
ccgttggagaagggcgagtgcgatttgctgggggagtgcatctattag

DBGET integrated database retrieval system