KEGG   Drosophila erecta: Dere_GG19743Help
Entry
Dere_GG19743      CDS       T01060                                 

Definition
GG19743 gene product from transcript GG19743-RA
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Dere_GG19743
Peptidases [BR:der01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dere_GG19743
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1414 aa AA seqDB search
MRVIAPRRSSTSAAGSGSLYGTSAAGTSSGSTTSSSSTSGSHHISSTGSVSGAVDRTSGG
ATTNGYSRISSSYDRGSSLSKWLPTSSGGSSSSGYGSSYYPSSYSTYSANSGSSSSSYAP
RSSVQRCSVGSTSSSSYLSGGSGSSSSAYRASSYLSGSSYDSPTYSRYGLPRKSASKITT
NGDSLSGSSKREDYGLRRGHDSTKKPPIIGGSGGHNSSSSAGRDTKAVDGSKRLSSSSSS
PSLARLVATSGLDIYEKYSPANYKPNCELSRSRSGHSEADLENGSNKETTPTCTVTLERP
RSSASRYSRLYSNSSDAGGDSSTSTPKLGSSKYSTSSSTGDVPTATFTLRSSRTRRSQVE
AAPTSTGVEQTGAAAPPPTPPTPPAPTPPPPPPPPPPTNGRKPAESNGGLEAKLNGLSLL
STSPKRNAIYERHQDTTDDAGHDVGQDSADNADVSTSATFKLNDGSKSTTQAASSPVAAS
GASPKEVPSAGGSAGSRVGATNPVRAANQRFFLVSSYKDPTFLKAECEVAHAHVTTNKVK
TTSQPHKRSRASEDSRNNNYNDSRAPTLVNMRRTSMFNGNQQQTTTTTTTSSSSSTTTIT
NTTSSSSRNTPSNTSNGVLKYSVRSTTATATATATAATSTSTRSYGKLKPLNNNQATAGA
AMMNGHTTNNNNNASGSSNINNGGNNNMQRQQQQHDDISYIDSDDPPATGGSGGGGVSTA
KTSICYFKPITPPLQLRHQQNQVQQQAQPSSSKSASHRYPRPKSTIIASAHLNFAASYEK
FSGGLYRQANGETNAESRTSSNARRYGIDSLSIKASIEKFNNLSGQKRQTPGSGSGTGPG
SGTGTGAGGGPLSGASRSNHASQAGGSSSNLQQRYSSDLDNIRVAAGYSSSLTRAAYRTT
ATMNSVSTPVAATSGLGQPTGGGVGGGGGAATAMVQPTSKVTVRGVHSNRQPNAIECDSL
ALSAKASKDATAAAAPTVATATATATPTPATSSVSTATATVTSTATATASNSASDSTLAR
SGTGSSSSARSVLPPMTPTSSRYWDRDSGTSRSSISTSSALNASSLKHNSDDGYKSASSS
RDEKSEGLCGLRNIGNTCFMNSVIQCLSHTQELTRFLRSHHGSRSSATKDQQILHEFAKL
IQEMWTSNVHTVTPMELKRAFSTKHRMYSDYNQQDAQEFLRFFLDSLHSALNSGVKGETL
NIDDNLSDNKKADLTWEWYTRHENSLVRDLFVGQLKSTLKCTTCGNTSVTFDPFWDLSVP
LPSSSRCKLEACLDLFIREEVLDGDEMPTCAKCKTRRKCTKSFTIQRFPKYLVIHLKRFS
ETRWSKLSNIVEFPTSDSELNMGSYGANSNSNVHYSLYAISNHMGSTAGGHYVALCKHPV
SRKWHEFNDNIVSEALSENHLVSSSAYILFYERT
NT seq 4245 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtaattgcgccgcgtagatcgtcaacgtcagcggcgggcagcggcagtctctac
ggtacatcggcggccggcacctccagcggcagcaccaccagcagcagctccaccagcggc
agtcaccacatcagcagcaccggcagcgtcagcggtgcggtggatcggaccagcggaggc
gccaccacgaacggttactcccgcatatcgagcagctacgaccgcggcagcagcctgtcc
aagtggctgcccacctcgtccggcggctccagctcgtcgggctacggcagcagctactat
cccagctcgtactcgacgtactccgccaacagcggctcctccagctcctcgtatgcgccg
cgctccagcgttcagaggtgcagcgttggttccacgtcgtcatcgtcgtatctgagcggc
ggatctggtagcagctcgtccgcctaccgcgcctcctcgtatctgagcgggtccagctat
gattcacctacgtacagccgatacggattaccgcgcaaatcggcgtccaagattaccacc
aacggcgacagcttgagcggttcgtccaagagggaggactacgggctgcggcgtggccac
gattctaccaagaagccaccgatcatcggaggaagtggtggccacaacagcagcagcagt
gcgggtagagacaccaaagccgtcgatggcagcaagcggctgtccagttcatcctcatcc
ccatcgctggcccgtttggtggccacctccggattggacatttacgaaaagtacagtccg
gccaactataaacccaactgtgaactgtcacgttccaggtcgggtcattctgaggcggat
ctggaaaacggaagcaacaaggagacgacgcccacctgcacggtgactctggagcggcca
cgtagcagcgccagtcggtacagccgcctgtacagcaacagcagcgatgcaggaggggac
tcctcgacctccacgccgaaactgggctcgagcaagtactccactagcagcagcactggc
gatgtgcccacggccacctttacactccgaagcagccgcacgcgacgcagccaggtggag
gcggcgcccacaagcacgggcgtggagcagactggcgcagcagctccaccaccgacgccg
ccaacaccaccagcaccaacaccaccgccgccaccacctccacctccgcctacaaatggg
cgaaagccggctgagtcgaatggcggactggaagccaaacttaacggcctgtcgctgctc
tcaacttcgcccaaaagaaatgccatttacgagcgccatcaggacaccaccgatgatgca
ggccatgatgttggccaggatagtgcggacaatgccgatgtgagcacctcggccacgttt
aagctgaacgacggcagcaagtccacaacgcaagcagcatcatcaccagtagccgcatca
ggagcaagtccaaaggaagtgccatcagcaggaggatcggcaggatcaagagtaggagct
accaatccggtgcgagcggccaaccagcgcttcttcctagtgtccagctacaaggaccct
acatttctgaaggccgaatgtgaggtggcccatgcccatgtgactaccaacaaggtgaaa
accacgtcgcagccgcacaagcggagtcgagcaagtgaggattcaaggaacaataactac
aacgatagccgggcaccaacgctggttaatatgcgacgcacgtccatgttcaatggcaat
cagcagcaaaccaccaccaccaccaccaccagcagcagcagcagcaccaccaccatcacc
aacaccacaagcagcagcagcaggaacacccccagtaacaccagcaacggagtgctcaag
tacagcgtccgctccacgacggcaactgcaacggcaactgcaacggcggcaacttctacg
tctaccaggagttacggcaagctgaaaccgctcaataacaaccaagcgaccgctggagca
gctatgatgaatggacacaccactaacaacaataacaacgccagtggcagcagcaacatc
aacaacggcggcaataacaacatgcaacgccagcaacagcaacacgatgacattagctac
atagacagcgatgatccgccggcaactggtggctctggaggcggcggagtatccactgcc
aagacgagcatttgctacttcaagcccatcacgccgccgctgcagctgcggcaccagcaa
aatcaagttcagcagcaggcgcagcccagcagctccaagtcggccagccatcgctatcca
cgacccaagtccaccataatagcatctgcccacttgaatttcgcggccagctatgagaaa
ttcagtggtggtctctataggcaggccaatggcgagacgaacgcggagagcaggaccagc
agcaatgccagaagatacggcattgattcgctgagcatcaaggcctccatagagaagttc
aacaacctcagtggtcagaagaggcaaactccgggctctggatcgggaacaggacctggc
agtggcacaggcacaggtgcgggaggcggaccgttgtccggcgccagccgtagcaatcac
gcatcgcaggcaggtggtagcagcagcaacctgcagcagcgctacagcagcgacctggac
aacatccgcgtggcggctggatacagtagttccctgaccagagccgcctatcgcactaca
gccaccatgaatagtgttagcacgccggtagcggccacctctggattaggccaacccact
ggcggcggcgtcggaggaggaggaggagccgccacggcaatggtccagcccacgagcaag
gtaacggtgcgaggtgttcacagcaaccggcagccgaatgcgatcgaatgcgatagcctg
gccctgagcgccaaggcaagcaaggatgcaacggcagcagcagcacctactgttgccact
gccactgccactgcaacacccacaccagccacgtcttccgtctccacagccacagccaca
gtcacatccacagccacagccacagcttcgaactcagccagcgatagtacactggcgaga
agcggcactgggagtagcagcagtgcccggagcgtcctgccgcccatgacgcccacgtca
agtcggtactgggatcgggacagcggcaccagccgcagcagcatcagcacctcctccgca
ctcaacgcgtcatccctgaaacacaactcggatgatggctacaagagcgcctcctcgtcg
cgggatgagaagtccgaagggctgtgcggtctgcgaaacatcgggaacacttgctttatg
aactcggtcatccagtgcctgagtcacacccaagagctgacccgcttcttgcggtcgcac
cacggctctcgctcgtcagccaccaaggatcagcagatactccacgaatttgccaaactc
attcaggagatgtggacctccaacgtgcacacggtgacgcccatggagctaaagagggcg
ttctccaccaaacaccgcatgtacagcgactacaaccaacaggatgcgcaggagttcctg
cgttttttccttgactcactgcattcggccctcaactcgggcgtcaagggtgagacgctc
aacattgatgataatctcagtgacaataagaaggcggacctgacctgggagtggtatacg
cggcacgagaactctctagtgcgtgacctcttcgtgggtcagctcaaaagcacactgaag
tgcaccacctgcggcaacaccagcgtcaccttcgatccgttctgggatctgagcgtaccg
ttgccgtcctcgtctcgctgcaagctagaggcttgcctcgacctctttatccgcgaagag
gtcctcgacggcgacgaaatgcccacgtgcgccaagtgcaagacgcggcgaaaatgcacc
aaaagcttcaccatccagcgtttccccaaatatctggttatacacctaaaacgcttctcg
gagacgcgctggagcaagctgtccaacatcgttgaatttcccacatcagacagcgagctg
aacatgggctcctatggcgccaactccaactcgaatgtgcattactcgctctatgcgata
tcgaatcatatgggctcaacggctggtggtcattatgttgccctttgcaagcacccagtc
tcccgcaagtggcacgaatttaatgataatatagtcagcgaggccttgtccgaaaaccat
ctcgtttcatccagtgcctatattcttttctacgagcgtacgtaa

DBGET integrated database retrieval system