KEGG   Drosophila erecta: Dere_GG19743Help
Entry
Dere_GG19743      CDS       T01060                                 

Definition
(RefSeq) GG19743 gene product from transcript GG19743-RD
  KO
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.4.19.12]
Organism
der  Drosophila erecta
Brite
Enzymes [BR:der01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dere_GG19743
Peptidases [BR:der01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Dere_GG19743
Ubiquitin system [BR:der04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dere_GG19743
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
Position
Unknown
AA seq 968 aa AA seqDB search
MMLDIKKTRGFHKIPQASKLQSTTQAASSPVAASGASPKEVPSAGGSAGSRVGATNPVRA
ANQRFFLVSSYKDPTFLKAECEVAHAHVTTNKVKTTSQPHKRSRASEDSRNNNYNDSRAP
TLVNMRRTSMFNGNQQQTTTTTTTSSSSSTTTITNTTSSSSRNTPSNTSNGVLKYSVRST
TATATATATAATSTSTRSYGKLKPLNNNQATAGAAMMNGHTTNNNNNASGSSNINNGGNN
NMQRQQQQHDDISYIDSDDPPATGGSGGGGVSTAKTSICYFKPITPPLQLRHQQNQVQQQ
AQPSSSKSASHRYPRPKSTIIASAHLNFAASYEKFSGGLYRQANGETNAESRTSSNARRY
GIDSLSIKASIEKFNNLSGQKRQTPGSGSGTGPGSGTGTGAGGGPLSGASRSNHASQAGG
SSSNLQQRYSSDLDNIRVAAGYSSSLTRAAYRTTATMNSVSTPVAATSGLGQPTGGGVGG
GGGAATAMVQPTSKVTVRGVHSNRQPNAIECDSLALSAKASKDATAAAAPTVATATATAT
PTPATSSVSTATATVTSTATATASNSASDSTLARSGTGSSSSARSVLPPMTPTSSRYWDR
DSGTSRSSISTSSALNASSLKHNSDDGYKSASSSRDEKSEGLCGLRNIGNTCFMNSVIQC
LSHTQELTRFLRSHHGSRSSATKDQQILHEFAKLIQEMWTSNVHTVTPMELKRAFSTKHR
MYSDYNQQDAQEFLRFFLDSLHSALNSGVKGETLNIDDNLSDNKKADLTWEWYTRHENSL
VRDLFVGQLKSTLKCTTCGNTSVTFDPFWDLSVPLPSSSRCKLEACLDLFIREEVLDGDE
MPTCAKCKTRRKCTKSFTIQRFPKYLVIHLKRFSETRWSKLSNIVEFPTSDSELNMGSYG
ANSNSNVHYSLYAISNHMGSTAGGHYVALCKHPVSRKWHEFNDNIVSEALSENHLVSSSA
YILFYERT
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atgatgttagacattaagaagaccaggggattccacaagattccacaggcatccaaatta
cagtccacaacgcaagcagcatcatcaccagtagccgcatcaggagcaagtccaaaggaa
gtgccatcagcaggaggatcggcaggatcaagagtaggagctaccaatccggtgcgagcg
gccaaccagcgcttcttcctagtgtccagctacaaggaccctacatttctgaaggccgaa
tgtgaggtggcccatgcccatgtgactaccaacaaggtgaaaaccacgtcgcagccgcac
aagcggagtcgagcaagtgaggattcaaggaacaataactacaacgatagccgggcacca
acgctggttaatatgcgacgcacgtccatgttcaatggcaatcagcagcaaaccaccacc
accaccaccaccagcagcagcagcagcaccaccaccatcaccaacaccacaagcagcagc
agcaggaacacccccagtaacaccagcaacggagtgctcaagtacagcgtccgctccacg
acggcaactgcaacggcaactgcaacggcggcaacttctacgtctaccaggagttacggc
aagctgaaaccgctcaataacaaccaagcgaccgctggagcagctatgatgaatggacac
accactaacaacaataacaacgccagtggcagcagcaacatcaacaacggcggcaataac
aacatgcaacgccagcaacagcaacacgatgacattagctacatagacagcgatgatccg
ccggcaactggtggctctggaggcggcggagtatccactgccaagacgagcatttgctac
ttcaagcccatcacgccgccgctgcagctgcggcaccagcaaaatcaagttcagcagcag
gcgcagcccagcagctccaagtcggccagccatcgctatccacgacccaagtccaccata
atagcatctgcccacttgaatttcgcggccagctatgagaaattcagtggtggtctctat
aggcaggccaatggcgagacgaacgcggagagcaggaccagcagcaatgccagaagatac
ggcattgattcgctgagcatcaaggcctccatagagaagttcaacaacctcagtggtcag
aagaggcaaactccgggctctggatcgggaacaggacctggcagtggcacaggcacaggt
gcgggaggcggaccgttgtccggcgccagccgtagcaatcacgcatcgcaggcaggtggt
agcagcagcaacctgcagcagcgctacagcagcgacctggacaacatccgcgtggcggct
ggatacagtagttccctgaccagagccgcctatcgcactacagccaccatgaatagtgtt
agcacgccggtagcggccacctctggattaggccaacccactggcggcggcgtcggagga
ggaggaggagccgccacggcaatggtccagcccacgagcaaggtaacggtgcgaggtgtt
cacagcaaccggcagccgaatgcgatcgaatgcgatagcctggccctgagcgccaaggca
agcaaggatgcaacggcagcagcagcacctactgttgccactgccactgccactgcaaca
cccacaccagccacgtcttccgtctccacagccacagccacagtcacatccacagccaca
gccacagcttcgaactcagccagcgatagtacactggcgagaagcggcactgggagtagc
agcagtgcccggagcgtcctgccgcccatgacgcccacgtcaagtcggtactgggatcgg
gacagcggcaccagccgcagcagcatcagcacctcctccgcactcaacgcgtcatccctg
aaacacaactcggatgatggctacaagagcgcctcctcgtcgcgggatgagaagtccgaa
gggctgtgcggtctgcgaaacatcgggaacacttgctttatgaactcggtcatccagtgc
ctgagtcacacccaagagctgacccgcttcttgcggtcgcaccacggctctcgctcgtca
gccaccaaggatcagcagatactccacgaatttgccaaactcattcaggagatgtggacc
tccaacgtgcacacggtgacgcccatggagctaaagagggcgttctccaccaaacaccgc
atgtacagcgactacaaccaacaggatgcgcaggagttcctgcgttttttccttgactca
ctgcattcggccctcaactcgggcgtcaagggtgagacgctcaacattgatgataatctc
agtgacaataagaaggcggacctgacctgggagtggtatacgcggcacgagaactctcta
gtgcgtgacctcttcgtgggtcagctcaaaagcacactgaagtgcaccacctgcggcaac
accagcgtcaccttcgatccgttctgggatctgagcgtaccgttgccgtcctcgtctcgc
tgcaagctagaggcttgcctcgacctctttatccgcgaagaggtcctcgacggcgacgaa
atgcccacgtgcgccaagtgcaagacgcggcgaaaatgcaccaaaagcttcaccatccag
cgtttccccaaatatctggttatacacctaaaacgcttctcggagacgcgctggagcaag
ctgtccaacatcgttgaatttcccacatcagacagcgagctgaacatgggctcctatggc
gccaactccaactcgaatgtgcattactcgctctatgcgatatcgaatcatatgggctca
acggctggtggtcattatgttgccctttgcaagcacccagtctcccgcaagtggcacgaa
tttaatgataatatagtcagcgaggccttgtccgaaaaccatctcgtttcatccagtgcc
tatattcttttctacgagcgtacgtaa

DBGET integrated database retrieval system