KEGG   Drosophila erecta: Dere_GG20096Help
Entry
Dere_GG20096      CDS       T01060                                 

Definition
GG20096 gene product from transcript GG20096-RA
Orthology
K04437  
filamin
Organism
der  Drosophila erecta
Brite
Exosome [BR:der04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dere_GG20096
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1356 aa AA seqDB search
MRLQMSERPAGQSVPAQVHQSADGVFKAEFVPRVVGEHRVNVTVNGLPTAGSPYAAKVYD
VSAIKVKNVSSGTVGKAVTFLVETSQAGPGNLEVTVNGGRVPTSAQAQGQHTYAISFTPR
EAESHTVELRFNSQDVPGSPFTCRVAAAARIQSPETMDKVSVGRLFEFVVESDTKPTVEV
LGPARRSVPVKIDPLGTSTLGYNVKFEPMEVGDHSVEVRLPGGGHVEGSPFLLKAYSAEK
VIVTDIRAGVVNKSVSFGINASQAGAGNLEIIVAVNGKNVPNFVQSEGNARFKVNFKPTE
AATHSLSVRFNGHPVPGSPFSCHIAAAAASPSMGLPRAMAMGECLKQAAVKMDNTFELEG
FEGVEPQIFVTSPSGDNEHCQLSQHDGGSYSASFRPTTVGRHLISVTANDQHINGSPFSC
NVFDVSRVSISGLEQQYGPANLGVPVTFSVDAAGAGEGTLELVVSTDSSTVKAEVVACAR
GLYDVTFVPQSTEPHYVNITFNEVAVDGSPFRVDIQQHTQHIQIGSLAAIDFPADDQIVE
IFSPDQKSVPYSINRQTAEFRTHMTGNYTLRFIDRETRQHIGSRTLCVFDPTLVKITEVS
EAFCHRPASIGVSLNEAGQGDLSALVRCGATEVPHTIRGPSKTGVYEIVYQPTRVAPHKI
SILFNDVPISLKPLEINVLPASAGKEISVSGLGLYQSRVGKTTSFAIDTVKRPAREFDVV
VSGPGGQALPVRCYQTKNGHLQAEFTINKPGQCVIEVLHQSKPLPGSPFTCESFDSSKVS
TQGVSKEPLALHSPNSFTVRTDNAGTAELEAFAISPSNQSIPVLIGEQSDGVYNVEFVPS
QPGNYKLTLMYGGETIPSSPLNFTASSSGVRNDARAAGHGLEVCHRNKEASFVVYCPIAP
NVQIERLDEYGERIEPKIKALGNNEWRISYTILSVGKYEIRASCPNRGSLPGSPWHISCV
ESNKVTPVGGWGTLVDHDGRLILPARIVFDVENAGPGKLVCSIDGIEIPVDKLVDGKMCL
NITGENLAAGEHDLDLTWSGLTITQCPRSAFVTGQQAADKVQLMGRGLAAAQAGEAAHFT
IDASNAPAGRPEVILTSQDNTSLPVSLAQPRPSENIWLASYTPLKSTTGTLNLSVKWNGR
LVKGCPLTVAVGSSMDASKVIASGEGLRHGIVGKDIKSWIDTRRAGPGELTAHCAGVRKV
AYCELYDHGDATFTLNIKPQEPGRHLLTIKYGGQNVPGSPFALKVAGAPDASKVRVYGPG
IEHGVLATFQSRFICDTRGAGAGQLTVRVRGPKGAFRVEMQRESQKDRTILCKYDPTEPG
DYRVEVKWAGEFVPGSPFPVMIFDTEEELRRYLQGI
NT seq 4071 nt NT seq  +upstreamnt  +downstreamnt
atgagactccaaatgagcgagagacctgctggccaatcggtgccggcgcaagtgcatcag
tccgcagatggcgtcttcaaggcggagtttgtgccccgggtcgtgggtgagcaccgggtc
aatgtcacggtcaacggattacccaccgccggcagtccatatgcagccaaggtctacgat
gtcagcgccatcaaggtgaagaatgtgagtagtggcacggtgggcaaggcggtcacattc
ctcgtggagacatcccaggccggacccggtaacctagaggtgaccgtcaacggaggcagg
gttccgacctcagcccaagcccagggtcagcacacctatgccatcagcttcacgccccgc
gaggccgagagtcacaccgtggagctgcgcttcaatagccaggatgttccgggatcaccg
ttcacctgccgtgtggcagctgccgctcgtatccagtcgccggagaccatggacaaggtc
agcgtggggcggctgtttgagttcgtggtggagtcggacacaaagccgacggtcgaggta
ctcggtcctgccaggcgcagtgtgcccgtgaagattgacccactgggtacgtccaccctg
ggctacaatgtgaaattcgagcccatggaagttggcgaccactcggtagaggttcgtttg
cccggcggcggtcacgtggagggcagtcccttcctgctgaaggcctactccgccgagaag
gttatagtcacggatatccgtgctggtgtggtgaacaagagcgtgagctttgggatcaat
gcctcgcaggcaggagccggcaacctggagataattgtggccgttaatggcaagaacgtg
ccgaactttgtccaatccgagggcaatgcccggttcaaggtgaacttcaagcccacggag
gcggccacccactcgctgtcggtgcgattcaatggacatccggtgccgggttcgccattc
agctgccacatcgccgctgccgctgcttcgccctcgatgggattgccccgggccatggcc
atgggagaatgcctgaagcaagctgccgtcaagatggacaacacctttgagctcgagggc
tttgagggcgtggagccgcagatctttgtgacctcgccatcgggggacaatgagcactgc
cagttgagccagcacgacggaggcagttactccgcctcgttccgccccaccacagtgggt
cgccacttgatcagtgtgacagccaacgatcagcacatcaacggatcacccttcagttgc
aacgtgtttgacgtatccagggtgagcatcagtggactggagcagcagtatgggcccgcc
aacctgggcgttccagttaccttcagcgttgacgctgccggagcaggagagggaaccctg
gagctggtggtctccacggacagcagcaccgttaaggccgaggtggtggcctgtgcccgt
ggcctgtacgatgtgaccttcgtgccccaaagcacggaaccccactacgtgaacatcact
ttcaacgaggtggccgtggacggaagccccttccgcgtggacatccagcagcacacgcag
cacattcagatcggtagtttggcggccattgatttcccagcggacgatcagatcgttgag
atattctcgccggatcagaagtcagttccgtactcaattaaccggcagacggccgagttc
cggacccacatgaccgggaactacaccttgcgttttatcgatcgggagacccgtcagcac
attggatcccgcactttgtgcgtctttgatcccacgctggtgaagatcaccgaggtgagc
gaggcattctgccatcgtccagccagcattggagtgtccttaaacgaagctgggcaggga
gacctgtcggctttggtgcgttgtggcgccaccgaagtgccacacaccattcgcggacct
agcaagactggagtatatgagatagtttaccagcccacgcgtgttgctccccacaagatc
agcatactcttcaacgatgtgcccatttccctgaaacccctggagatcaatgtcctgccc
gccagtgctggcaaggaaatcagcgtcagtggactgggactgtaccagtcgcgagttgga
aagaccacttcctttgccatcgacacagtcaagaggccagctagggagttcgatgtggtg
gtctccggaccaggcggacaagctcttccggtgagatgttatcagaccaagaacggacac
ctgcaggcggagttcaccatcaacaagcccggacagtgtgtcattgaggtactccaccaa
tcgaagcctctgcccggaagcccatttacgtgtgagtcctttgacagcagcaaggtcagc
acccaaggagtctccaaggaaccactggcccttcacagtccaaacagtttcacagtgcgc
acggataatgccggaaccgccgaactggaggctttcgccatatcgccaagcaatcagagc
attcccgttctcattggcgagcaatcggatggggtctacaacgtggagtttgtgccctcg
cagccgggcaactacaagctgaccctcatgtacggaggcgagacgattcccagctcaccg
ctgaactttaccgcctcgtccagtggcgtaaggaatgacgcccgtgcagctggacacgga
ctggaggtgtgccaccggaacaaagaggcatccttcgtggtctactgccccattgcgccg
aatgtccagatcgaacgattggacgagtatggtgagcggatagagcccaagatcaaggct
ctgggcaacaatgagtggcgcatctcctacacaattctgtccgtgggaaaatacgagatt
cgagccagctgtcccaaccggggaagcttgccgggatcgccatggcacatcagttgcgtg
gagtctaacaaggttacacctgtgggcggctggggaaccctcgttgatcacgatggccgg
ctgattctgcccgctcgtattgttttcgatgtggagaatgcgggaccgggaaaactggtt
tgcagcatcgatggcatcgaaataccggtggacaagttggtcgacggcaagatgtgtctt
aacatcactggcgagaacctggctgccggcgagcatgacttggacttgacttggagcggc
ctgaccatcacccagtgccccaggagtgccttcgtcacaggtcaacaggcggcggataag
gttcagcttatgggtcgcggtctggctgcagcgcaagctggggaggctgcccacttcacg
attgatgcctccaatgcgccggctggcagaccagaggtgatcctcaccagccaggacaac
acatcgctgccagtgagtttggcgcaaccaagaccaagcgaaaacatctggttggcctcc
tatactccgctgaaatccacaactggtactctgaatctctctgtaaagtggaacggtcgt
ttggtcaagggatgtccgcttacggtggcagtgggttcatcaatggatgcctcaaaggtg
atagcctccggcgagggactgcgtcacggcattgtgggcaaggacattaagtcctggata
gacaccaggagagcaggacccggcgaactcaccgcccattgtgctggtgtacggaaagtt
gcctactgcgaactatacgatcatggcgatgccacattcaccctgaacatcaagccccag
gaaccaggtcgccatctgctgaccatcaagtacggcggacagaatgttcccggctcgcca
tttgcactgaaagtggccggggcaccggatgccagtaaggtccgcgtttatggtcctgga
atcgagcatggcgtgctggccaccttccagtcgcgcttcatctgcgacacccgaggagct
ggagctggtcaactgacagttagggtccgtggacccaaaggagctttccgcgtggagatg
cagcgcgagagccagaaggatcgcaccatcctgtgcaagtacgatccaaccgagccgggc
gactatcgcgtggaggtcaaatgggcgggcgaattcgtgccaggatcgccgttccccgtc
atgatcttcgacactgaggaggagttacgaaggtacttgcagggcatatga

DBGET integrated database retrieval system