KEGG   Drosophila erecta: Dere_GG20097Help
Entry
Dere_GG20097      CDS       T01060                                 

Definition
GG20097 gene product from transcript GG20097-RA
Orthology
K04437  
filamin
Organism
der  Drosophila erecta
Brite
Exosome [BR:der04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dere_GG20097
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 1622 aa AA seqDB search
MDVKDIKGAKVTHAGLLKHNSDGTTETQKITHAGLVARSPEGTAAKGMNIRGNEDLWVEI
QANTFRNWVNEHLRETGMQLMLISIVFQVHDWATDFCDGTCLCALVENLQTRPLKPSWNR
RPANQHHYLENATTALKSIEADHIKLVNIGNVDIVNGNIKLILGLIWSLIVRYQIGRSKF
PPRKLMLAWLQAALPDCRITNLTTDWNSGVNLAALLDYCQPGLFPHWRSLDPSQSVRNCT
QAMDLAQREFGVPKVLEPEYLASPWLDELSGMTYLSYFMKPGGPGYNATMRWVNTQVKDS
VKNFTTDWNDGRVMCEIIKGLGGSAPAPEKLSTDPFHYENNIRKAVDAGAKLGVQPILTA
KDMANPEVEHLGIMAYAAHLQWVPPRPPLSDLVSVYLESTSGRVGEPTHFRIDVMSRDIS
LSSVRCHVVPPSGQPAQSVRLNAHGEGVFVPERYGMHEIVVEIGEDSLGGHFFRALPRLL
QVAPPGMAPCALGSLVEVLVNATGAPKTEDILVTAVSPTGISHNCPLKKIDEGHSAIFKP
DEAGIWEIAITYQGRHIQGGPFTCAVFDASGVSVHGLDGAMPLRAHTFEVDARGVGVSGE
LHVDIVHDKHSLVCSVEKIVENKYRVTFMPRQNGKYRVYIYFNGYDVKGSPFIMRVGTKG
RSGKTRSSPLHDSKHRSESPSMHFVSTTNTRHNDYRNSSLSRHNTAERTNSYSPQYSPKL
DTTDYHSSSSRYYKRESEENHATSPPAPPPVSGSPTVKYLNSADLYTETLNGRRDSKTSN
SSSTKNDYYYDKENELYSQRRAVTKPKLTPPREERELTSTTNTSSSSSFQQRHQQLATST
LTRSLSPIPSPTLNTRSSEVHTHSPLTIKTSNQYESSTRNITSSPRHASVSPVQRYSPNS
AYITTATHRMGSPLTSPVSKNGYESSRTVEKSSTYKSTSNYVTDSNIRASPSLYGTAERL
RRTGSPEPRIDHSSNVRVSSMKPASARRDSWDVINKTKHMLSHNSLESLANMTEKQLNTE
LQYNRPDLDHETHRNTQYNKFALHKQQQHQSDYRRDSPDDGERYKPSAITVKSHSNNTYT
DKSGGYTKTVKESSEHVVTESNGHGPSPGYGYSSLSRFRPIDNNATGARAIRVQDIPNGS
IGRPVEFEIDGSRAGSGNLEILVNGGRVTSSVRSLGGQRFIASFTPHEHGTHTVQITFNG
ETVPGSPWHAEIMSSPGLTALGESTRLVPANTPAVFEILPPPGQSLSKGECVATVLTPSK
SKLNARVTHEAANGAARIEFVPTEVGTHVIDASINGTKIAGGPLIAKVYDSSLIQVTEVN
GGVVGQPCQFRVDASAAGEGQLEISINEGEVPNHVQVVGGGRCLVSFTPEQAKSHLIDIK
FNGETVRGCPFVCAVADTSRVLLNLSNLELIPVNRPSSFHITVSGGGAAELAVSVRGPQG
ELPVRVTGDIHAGFTAEFTPTTVGGHSINVEYNGFAVQGTPFLAKSYDASKVVVGSVSRG
TMGRPVQFTVDAGDAGEGNLEITISAKGQNIPTQVHPQGSARFSVSFVPTESCEHTINVS
FNKMPVPGCPITVSISGGVAGPQVSLGGPGPVHQTNSFVINHNGGRLEDIEVNVEGRRKL
LY
NT seq 4869 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcaaggacataaaaggcgccaaggtgacgcatgcggggctgctcaagcacaac
tccgatggcaccaccgagacgcagaagatcacccacgccggactggtggcccggagtccc
gagggcaccgccgccaagggcatgaacatccggggcaacgaggatctctgggtggagatc
caggcgaacacattccgcaactgggtcaacgagcatttgcgcgagacgggaatgcagttg
atgctaatttctattgtctttcaggtacatgactgggccaccgatttctgcgatggcact
tgtctgtgcgcccttgtggagaacctgcagacgcgtccactgaaaccctcatggaatcgc
cgacccgcgaaccagcatcattatctggagaacgccaccacggcactgaagtccattgag
gccgaccacatcaagctggtgaacatcggcaacgtggacatcgtgaatgggaacataaag
ctgatcctgggcctgatctggtccctcatcgtgcgctatcagatcggaaggagcaagttc
ccgccgcgcaaactgatgctggcctggctgcaggccgctctgccggactgcaggatcacc
aatctgaccaccgattggaatagtggcgtcaatctggcggcgctcctggactactgccag
ccgggcttgttcccgcactggcgcagtctcgatcccagccagagtgtgcgcaactgcacc
caggccatggacttggcccagcgcgagtttggagtgccaaaggtcctggagccggagtac
ctggcctcaccctggctggatgagctatccggcatgacgtacctctcgtacttcatgaag
cccggtggtcctggttacaatgccaccatgcgatgggtgaatacgcaggtcaaggactct
gtgaagaactttacgaccgactggaacgatggacgcgtcatgtgcgaaattattaaggga
ctgggtggctcggcgcccgcaccggagaagctcagtacggatcccttccactacgagaac
aacatacggaaggcggtggacgcgggtgccaagctgggcgtgcagcccatcctgacggcc
aaggacatggccaacccggaagtggagcacctgggcatcatggcctacgcggcccacctg
cagtgggtgccgccgaggcctccgctgtccgacctggtcagcgtttacctggagagtaca
tccggtcgggtgggcgaaccgacccacttccgcatcgacgtaatgtcccgggacataagc
ctcagctcagtacgctgccacgtggttcctccgtccggacagccggcacagtccgtgcgg
ctcaatgcccacggcgagggagtctttgtgccggagcgctacgggatgcacgagattgtg
gtggagatcggcgaggacagcctgggcggacacttcttccgagctctgccccgcttactg
caggtggctcctccgggaatggcgccctgtgccttgggcagtctcgtcgaggtgctggtc
aatgccaccggtgcgcccaaaacggaggacatcctggtgacggcggtctcgcccacgggc
atctcgcacaactgcccgctgaagaagatcgacgagggacacagtgccatattcaagccg
gacgaggcgggtatctgggagatagccatcacctaccagggtcgccacatccagggcgga
cccttcacttgtgccgtgttcgatgcatccggagtctcggtccatggtttggatggggcc
atgccgctgagggctcacaccttcgaggtggatgcccgtggagtgggtgtttctggcgag
ctgcacgtggacatagtgcacgacaagcattcgctggtctgctcggtggagaagatcgtg
gagaacaagtaccgggtgacctttatgcccaggcagaatggaaagtaccgcgtgtacatc
tacttcaatggctacgatgtcaaaggttcgcccttcatcatgcgtgtgggcaccaaggga
agatctggcaaaacgcggagcagtccgctgcacgacagcaagcaccgctcggagagtccc
tcgatgcacttcgtctccaccacgaacacccggcacaatgactaccgcaactcctcgctt
tcgaggcacaacacggctgagaggaccaacagctactcgccgcagtactcgcccaagttg
gacaccaccgactaccacagttcgagttccaggtactataagcgggagagcgaggagaac
cacgccacctcgccgccagctccaccaccagttagtggttctcccacggtcaagtaccta
aactccgccgatctgtatacggaaacgttaaacgggcgccgggactcgaagacctcgaac
agcagctccacgaagaacgactactactacgacaaggagaacgagctgtacagccagcgg
cgtgcagtgaccaagcccaagttgacgccaccgcgcgaggagcgcgagctgaccagcacc
accaataccagcagcagcagcagcttccagcagcgccaccagcagctggccaccagtacc
ctgaccagatcgcttagtccaatacctagtcccacactcaatactcgatccagcgaagtg
cacacccacagtccgttgaccatcaagacgtccaatcagtacgagagctccacgcggaac
atcaccagcagtccgcggcacgcctccgtttcgccggtgcaacgttattctcccaatagc
gcctatatcaccacggccactcaccggatgggaagtcccctaaccagccccgttagtaag
aatggttacgagtcgtcgcgcaccgtagaaaagtcatcgacctacaagtccacctcgaac
tacgtcaccgattcgaacattcgtgccagtccctcgctgtacggaactgccgagcgactg
cgtcgaaccggatcccccgagccacgcatcgaccactcctccaatgtgagggtgtcctcg
atgaagcccgcctccgccaggcgggacagctgggacgtcatcaacaagacgaagcacatg
ctctcgcacaattcgctcgaatcgctggcgaacatgaccgagaagcagctgaacacggaa
ctgcaatacaatcgcccggatttggatcacgagacgcaccggaacacccagtacaataag
ttcgccctgcacaaacagcagcagcaccagtcggactatcgccgggattcccctgacgat
ggagagcgctacaaacccagtgccattacagtcaagtcacattcgaacaacacctatacg
gacaagtccggtggatatacgaaaaccgtaaaggaatccagcgagcatgtggtcaccgag
agcaatggtcacggaccctccccgggatacggatacagctccctctccagatttcgaccc
atagataacaatgccactggtgccagggccattcgagtgcaggatattccgaatggctct
attggacggcccgtcgagttcgagatcgatggctcgagggcgggctccggcaatctggag
atcctggtcaacggcgggcgtgtcacctcctcggtccgctcgctgggaggtcagaggttc
attgccagcttcacgccccacgagcatggaacgcacacggtgcagatcaccttcaatggc
gaaaccgttccaggttcaccgtggcacgctgaaatcatgtcctcacccggcctgaccgct
ctgggcgaatccacgcgcctggtacccgccaatacgccggcggtttttgagatactgccg
cctcctggacaaagcctgagtaagggcgagtgcgtggcgacggttttgactcctagcaag
tcaaagctgaacgccagagtcacccatgaggcggcaaatggtgctgctcgcatcgagttc
gtgcccaccgaggtgggcacccacgtgatcgatgcgtccatcaacggcacgaagatcgct
ggcggcccgctgatcgccaaggtctacgactccagcctgatccaggtgacggaggtgaat
ggcggcgtggtcggccagccgtgccagttccgtgtggatgccagcgccgccggcgagggc
cagctggagatatccatcaatgagggcgaggtgcccaatcatgtccaggtggtgggcggc
ggtcgctgcctggtctccttcacgccggagcaggccaagtcgcatctgattgacatcaag
ttcaacggcgaaacggtgcgcggctgtccctttgtctgcgccgtggcggacacctcgcga
gtgctcctgaatctctccaatctggagctgatcccggtcaatcggccctcctcctttcac
atcaccgtgagcggaggtggagctgccgagctggctgtcagcgtgcgcggtccccagggc
gagttgcccgtccgggtgaccggagatatccacgctggcttcacggccgagttcacgccc
accaccgttggcggccattcgatcaacgtggagtacaacggattcgccgtgcagggtacg
cccttcctggccaagtcatacgatgccagcaaggtggtggtgggcagcgtctcgcgtgga
acgatgggacgcccggtgcagttcaccgtggatgcgggcgacgccggtgagggcaacctg
gagatcacgatttcggccaagggacagaacattcccacgcaggtgcatccgcaaggcagt
gcaagattttccgtatcctttgtgcccacggaatcgtgcgagcacacgatcaacgtgtca
ttcaacaaaatgcccgtgccgggctgtccgatcacggtcagcatcagtgggggcgtggcc
gggccccaggtgtccttgggaggcccaggacccgtgcaccagaccaattcttttgtaatc
aatcacaatggcggccgtttggaggacatcgaggtgaacgtggaaggacggcgaaaactt
ttgtactag

DBGET integrated database retrieval system