KEGG   Drosophila erecta: Dere_GG20235Help
Entry
Dere_GG20235      CDS       T01060                                 

Definition
GG20235 gene product from transcript GG20235-RA
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
der  Drosophila erecta
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:der00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 596 aa AA seqDB search
MSNGRYGRFGALIGVACVSSTHCRFLIYSTKNAEVLAYHELKLRQIVHQAGWMEYDPSEI
WKNTQECIETAYKNLVILEINPHDIIAIGIVNQRGTSVLWNKETGQPLHNAIGWSDCRST
SILKSMLHNVRHNVDYVRYRSGLPLSSCFSALKIRWLMDHVPSVATAIEEKKCLFGTLDS
WLLWNLTGGVETGVHSTDLTNAHYTALMNLSTEQWDPKLCQFFRLPLNILPRIRSNSEIF
GYVLDGPLLGVPIAAMMGEQPASLLGQLCVKAGQNICTLDDSCFVLLNTGREKLDSTNGL
ITGVAHKLGEKEATNYTLEGAISNAGSTVTWLRDKLQISTEINSNDNVVESLNTFIGENS
MISSSCSSSMLNAECGLAAKRSEITFVPAFHGLYAPYWRHDARGIILGLTSQTTAENITQ
AAYEATGFQIFEVLQAFKSDTPNWDRSCMQPVLTFGGDYAENSHLVQFIADIIGYMMERP
QTTSPAGLGVMITAGVTMKVVSLKYAVQMYTPPTDVFAPMTTKNRRELLYRRWDYAVKKC
LHWNNYQTYEADVELFAQRELDPNLPVRRSIPGSVFLISSFALVLLANYLKNNPLK
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgggcgctacgggagattcggagcactcatcggtgtcgcctgcgtgagcagc
acccactgccgctttttgatttactcaaccaaaaatgccgaggtcctggcctaccatgag
ctcaagctgcgtcagattgtccaccaggcgggctggatggagtacgatccttccgagata
tggaagaacacacaagagtgcatagagaccgcctataagaacctggttatactggagatt
aatccacatgatattattgccatcggcatcgtaaatcaacgcggcacatcggtgttatgg
aataaggagacgggacagccgctgcacaatgccattggctggtcagattgccgcagcact
tccatactgaagagcatgctccataatgttcggcacaatgtggactacgtgaggtatcgc
agtggtttgcccctaagcagctgtttcagtgccctaaagatacgctggctgatggatcac
gttccttctgtagccactgccattgaggagaagaagtgcttattcggcaccttggactcc
tggcttctgtggaacctcaccggcggcgtggagacgggtgtgcactctacggacctcacc
aatgcccactacaccgcccttatgaacctatccacagagcagtgggatcctaaactctgc
cagttctttcgattgcccctgaacatactgccacgcatacgatccaactccgaaatattc
ggctatgtgctggatggtcccttgctgggcgttcccatagcggccatgatgggtgagcag
ccagcaagtttgctgggccagctctgcgtgaaggccgggcaaaatatttgcaccctggac
gatagctgtttcgtgctccttaacacgggcagggagaagctggactctacaaatggactg
ataacgggcgtagcgcacaagctgggcgaaaaagaggccactaactacacacttgaggga
gccatttcaaatgccggttccacggtgacatggctgcgggataaactacagatcagtact
gagataaattccaatgataatgtggtggagtctttaaatacattcatcggcgagaactcg
atgatctcgtcctcctgttcctcatccatgctgaacgccgagtgtggactggcggccaag
aggtcggagattacgtttgtgccggcatttcatggtttgtacgctccttactggcggcac
gatgccaggggcataatcttgggacttaccagccagacaacagcggaaaacatcacccaa
gctgcttacgaggccaccgggttccagatctttgaagtgctacaggcgttcaagagcgat
acacccaactgggaccgctcctgcatgcagcctgtgctcacgttcggcggcgattacgcc
gagaactcgcatctggtgcagttcattgcggacatcatcggctacatgatggagcggccg
cagaccacctcgcctgcaggtttgggcgttatgataaccgcgggcgtgacgatgaaagtg
gtgtccctcaagtacgccgttcaaatgtacacaccgcccacggatgtctttgcgcctatg
actaccaaaaatcgtcgagagctgctctacaggcgctgggattatgcggtaaagaaatgc
ctgcactggaacaactaccagacgtacgaggctgatgtcgagctgtttgctcagcgagaa
cttgatcccaatttacctgttaggcgttctattcccggcagtgtatttctgatttcatca
tttgccctcgtcctcctggctaactacttaaagaacaatcccctgaaatag

DBGET integrated database retrieval system