KEGG   Drosophila erecta: Dere_GG20360Help
Entry
Dere_GG20360      CDS       T01060                                 

Definition
GG20360 gene product from transcript GG20360-RA
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
der  Drosophila erecta
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:der00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 685 aa AA seqDB search
MAEAKDIEKLFETDGYLRPFEHEIRRRHGVLQDWLNKINQSEGGMDGFSTAYKHYGLHFQ
PDNSVIAREWAPGARDVYLTGDFNNWHWESHPFKKLDFGKWELHLPPNEDGSPAIKHMSE
IKIIIRNHSGQLLDRLSPWAKYVVQPPKSANQGVNYKQYVWEPPSYERYQRQHQGPPRPK
SLRIYECHVGIASQEPRVGSYDEFADRIVPRIKRQGYNCIQVMAIMEHAYYASFGYQVTS
FYAASSRYGNPEQLKRMIDVAHSHGLFVLLDVVHSHASKNVQDGLNQFDGTNSCFFHDGA
RGEHSLWDSRLFNYVEYEVLRFLLSNLRWWHDEYNFDGYRFDGVTSMLYHSRGIGEGFSG
DYNEYFGLNVDTDALNYLGLANHLLHTIDSRIITIAEDVSGMPTLCRPVSEGGIGFDYRL
GMAIPDKWIELLKEQSDDEWDMGNLVHTLTNRRWMENTVAYAESHDQALVGDKTIAFWLM
DKEMYTHMSTLSDSSLIIDRGLAMHKMIRLITHALGGEAYLNFMGNEFGHPEWLDFPRVG
NNDSYHYARRQWNLVDDDLLKYKYLNEFDRAMNETEERYGWLHSGPAWVSWKHEGDKIIA
FERAGLVFVFNFHPQRSFTGYRVGTNWAGTYQAVLSSDDPLFGGHNRIDANCKHPSNPEG
YAGRSNFIEVYTPSRTAVVYARVSD
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggctaaggacatcgagaagctgttcgagacggacggctacttgcggccgttt
gagcacgagatccgtcgccgtcatggcgtgctccaggattggctgaataagataaaccaa
agcgagggcggaatggatggcttttcgacggcttacaagcactacgggcttcatttccag
ccggacaattcggtaattgcccgggagtgggcacctggagccagagatgtctatctcacg
ggtgacttcaacaactggcactgggaatcgcatccgttcaaaaagctcgacttcggtaag
tgggagctccacctgccacccaacgaggacggcagcccggccatcaagcacatgagcgaa
attaagattatcattcgcaaccattccggtcaattgctggaccgcctgtcgccctgggcc
aagtacgtggtgcagccgcccaagtcggccaaccagggggtcaactacaagcagtacgtg
tgggagccaccgtcctacgagcgctatcaacgccagcaccagggtccgcctagacccaag
tcgcttaggatatatgagtgccatgtgggtatcgcctctcaggagccgcgggtcggcagc
tacgacgagtttgccgatcgtattgtgccgcgcatcaagcgtcagggctataattgcatc
caggttatggccatcatggagcacgcttactacgccagtttcggctaccaagtgaccagc
ttctatgcggcctccagccgttatggcaacccggagcagctgaagcgcatgatcgacgtg
gcccactcgcacggccttttcgttctgctcgatgtggtccactcgcatgcctccaagaac
gtacaggatggcctgaaccagttcgatggcaccaacagttgcttcttccacgacggagcc
cgtggcgagcactcgctgtgggacagtcgtctcttcaactacgtcgagtacgaggtgctt
cgttttctgctatccaacctgcgttggtggcacgacgagtacaacttcgatggctatcgc
tttgacggagtaacctctatgttgtaccattcccgtggcattggggagggcttcagcggc
gactacaacgagtactttggcctgaacgtcgacacggatgccctcaattatctgggactg
gccaatcatctgctgcacaccatagactcgaggattatcactattgcagaggatgtttct
ggaatgcctaccctgtgtcgccccgtttccgagggtggtatcggattcgactaccgcctg
ggtatggccatcccagacaagtggatcgagctgctaaaggagcagagtgacgatgagtgg
gacatgggcaatctggtgcatacgctgaccaaccgtcgctggatggagaacacagtggcc
tacgcagagtcccacgatcaggcgctggtgggcgacaagacgatcgccttctggctgatg
gacaaggagatgtacacgcacatgtctacattgtcggactcctcattgatcatcgaccga
ggactggcgatgcacaagatgattcggttgatcacgcacgccctgggaggcgaggcgtac
ctgaactttatgggcaacgagttcggacatcccgaatggctggacttcccgcgcgttggc
aacaatgattcgtatcactatgctcgccggcaatggaatctggtggacgacgatctgctg
aagtacaagtacctcaacgagttcgatcgagccatgaacgagaccgaggagcgctacggc
tggctgcattccggacccgcttgggtcagctggaagcacgagggcgacaagatcatcgct
ttcgagcgtgccggcctggtgttcgtcttcaacttccatccccagcgaagcttcaccgga
taccgtgtgggcaccaactgggcgggcacctaccaggcggtgctctcctcagacgatcca
ctcttcggcggccacaaccgcatcgatgccaactgcaaacatccctccaatccggagggc
tacgccggtcgctccaatttcattgaggtctacacgccgtcacgcaccgccgtggtctac
gcccgcgtcagtgactag

DBGET integrated database retrieval system