KEGG   Drosophila erecta: Dere_GG20360Help
Entry
Dere_GG20360      CDS       T01060                                 

Definition
GG20360 gene product from transcript GG20360-RA
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
der  Drosophila erecta
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:der00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dere_GG20360
Enzymes [BR:der01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Dere_GG20360
Exosome [BR:der04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dere_GG20360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
FlyBase: 
UniProt: 
AA seq 685 aa AA seqDB search
MAEAKDIEKLFETDGYLRPFEHEIRRRHGVLQDWLNKINQSEGGMDGFSTAYKHYGLHFQ
PDNSVIAREWAPGARDVYLTGDFNNWHWESHPFKKLDFGKWELHLPPNEDGSPAIKHMSE
IKIIIRNHSGQLLDRLSPWAKYVVQPPKSANQGVNYKQYVWEPPSYERYQRQHQGPPRPK
SLRIYECHVGIASQEPRVGSYDEFADRIVPRIKRQGYNCIQVMAIMEHAYYASFGYQVTS
FYAASSRYGNPEQLKRMIDVAHSHGLFVLLDVVHSHASKNVQDGLNQFDGTNSCFFHDGA
RGEHSLWDSRLFNYVEYEVLRFLLSNLRWWHDEYNFDGYRFDGVTSMLYHSRGIGEGFSG
DYNEYFGLNVDTDALNYLGLANHLLHTIDSRIITIAEDVSGMPTLCRPVSEGGIGFDYRL
GMAIPDKWIELLKEQSDDEWDMGNLVHTLTNRRWMENTVAYAESHDQALVGDKTIAFWLM
DKEMYTHMSTLSDSSLIIDRGLAMHKMIRLITHALGGEAYLNFMGNEFGHPEWLDFPRVG
NNDSYHYARRQWNLVDDDLLKYKYLNEFDRAMNETEERYGWLHSGPAWVSWKHEGDKIIA
FERAGLVFVFNFHPQRSFTGYRVGTNWAGTYQAVLSSDDPLFGGHNRIDANCKHPSNPEG
YAGRSNFIEVYTPSRTAVVYARVSD
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggctaaggacatcgagaagctgttcgagacggacggctacttgcggccgttt
gagcacgagatccgtcgccgtcatggcgtgctccaggattggctgaataagataaaccaa
agcgagggcggaatggatggcttttcgacggcttacaagcactacgggcttcatttccag
ccggacaattcggtaattgcccgggagtgggcacctggagccagagatgtctatctcacg
ggtgacttcaacaactggcactgggaatcgcatccgttcaaaaagctcgacttcggtaag
tgggagctccacctgccacccaacgaggacggcagcccggccatcaagcacatgagcgaa
attaagattatcattcgcaaccattccggtcaattgctggaccgcctgtcgccctgggcc
aagtacgtggtgcagccgcccaagtcggccaaccagggggtcaactacaagcagtacgtg
tgggagccaccgtcctacgagcgctatcaacgccagcaccagggtccgcctagacccaag
tcgcttaggatatatgagtgccatgtgggtatcgcctctcaggagccgcgggtcggcagc
tacgacgagtttgccgatcgtattgtgccgcgcatcaagcgtcagggctataattgcatc
caggttatggccatcatggagcacgcttactacgccagtttcggctaccaagtgaccagc
ttctatgcggcctccagccgttatggcaacccggagcagctgaagcgcatgatcgacgtg
gcccactcgcacggccttttcgttctgctcgatgtggtccactcgcatgcctccaagaac
gtacaggatggcctgaaccagttcgatggcaccaacagttgcttcttccacgacggagcc
cgtggcgagcactcgctgtgggacagtcgtctcttcaactacgtcgagtacgaggtgctt
cgttttctgctatccaacctgcgttggtggcacgacgagtacaacttcgatggctatcgc
tttgacggagtaacctctatgttgtaccattcccgtggcattggggagggcttcagcggc
gactacaacgagtactttggcctgaacgtcgacacggatgccctcaattatctgggactg
gccaatcatctgctgcacaccatagactcgaggattatcactattgcagaggatgtttct
ggaatgcctaccctgtgtcgccccgtttccgagggtggtatcggattcgactaccgcctg
ggtatggccatcccagacaagtggatcgagctgctaaaggagcagagtgacgatgagtgg
gacatgggcaatctggtgcatacgctgaccaaccgtcgctggatggagaacacagtggcc
tacgcagagtcccacgatcaggcgctggtgggcgacaagacgatcgccttctggctgatg
gacaaggagatgtacacgcacatgtctacattgtcggactcctcattgatcatcgaccga
ggactggcgatgcacaagatgattcggttgatcacgcacgccctgggaggcgaggcgtac
ctgaactttatgggcaacgagttcggacatcccgaatggctggacttcccgcgcgttggc
aacaatgattcgtatcactatgctcgccggcaatggaatctggtggacgacgatctgctg
aagtacaagtacctcaacgagttcgatcgagccatgaacgagaccgaggagcgctacggc
tggctgcattccggacccgcttgggtcagctggaagcacgagggcgacaagatcatcgct
ttcgagcgtgccggcctggtgttcgtcttcaacttccatccccagcgaagcttcaccgga
taccgtgtgggcaccaactgggcgggcacctaccaggcggtgctctcctcagacgatcca
ctcttcggcggccacaaccgcatcgatgccaactgcaaacatccctccaatccggagggc
tacgccggtcgctccaatttcattgaggtctacacgccgtcacgcaccgccgtggtctac
gcccgcgtcagtgactag

DBGET integrated database retrieval system